KEGG   Homo sapiens (human): 6657Help
Entry
6657              CDS       T01001                                 

Gene name
SOX2, ANOP3, MCOPS3
Definition
SRY (sex determining region Y)-box 2
Orthology
K16796  
transcription factor SOX2 (SOX group B)
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Disease
H00544  
Septo-optic dysplasia
H01027  
Anophthalmia and microphthalmia (A/M)
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.3-q27
AA seq 317 aa AA seqDB search
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMA
QENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM
KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGY
PQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacatgatggagacggagctgaagccgccgggcccgcagcaaacttcggggggc
ggcggcggcaactccaccgcggcggcggccggcggcaaccagaaaaacagcccggaccgc
gtcaagcggcccatgaatgccttcatggtgtggtcccgcgggcagcggcgcaagatggcc
caggagaaccccaagatgcacaactcggagatcagcaagcgcctgggcgccgagtggaaa
cttttgtcggagacggagaagcggccgttcatcgacgaggctaagcggctgcgagcgctg
cacatgaaggagcacccggattataaataccggccccggcggaaaaccaagacgctcatg
aagaaggataagtacacgctgcccggcgggctgctggcccccggcggcaatagcatggcg
agcggggtcggggtgggcgccggcctgggcgcgggcgtgaaccagcgcatggacagttac
gcgcacatgaacggctggagcaacggcagctacagcatgatgcaggaccagctgggctac
ccgcagcacccgggcctcaatgcgcacggcgcagcgcagatgcagcccatgcaccgctac
gacgtgagcgccctgcagtacaactccatgaccagctcgcagacctacatgaacggctcg
cccacctacagcatgtcctactcgcagcagggcacccctggcatggctcttggctccatg
ggttcggtggtcaagtccgaggccagctccagcccccctgtggttacctcttcctcccac
tccagggcgccctgccaggccggggacctccgggacatgatcagcatgtatctccccggc
gccgaggtgccggaacccgccgcccccagcagacttcacatgtcccagcactaccagagc
ggcccggtgcccggcacggccattaacggcacactgcccctctcacacatgtga

DBGET integrated database retrieval system