KEGG   Homo sapiens (human): 6657Help
Entry
6657              CDS       T01001                                 

Gene name
SOX2, ANOP3, MCOPS3
Definition
(RefSeq) SRY-box 2
  KO
K16796  transcription factor SOX2 (SOX group B)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00544  Septo-optic dysplasia
H01027  Anophthalmia and microphthalmia (A/M)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    6657 (SOX2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6657 (SOX2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    6657 (SOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOXp HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 6657
NCBI-ProteinID: NP_003097
OMIM: 184429
HGNC: 11195
Ensembl: ENSG00000181449
Vega: OTTHUMG00000158222
Pharos: P48431(Tbio)
UniProt: P48431 A0A0U3FYV6
Structure
PDB: 

Jmol
Position
3q26.33
AA seq 317 aa AA seqDB search
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMA
QENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM
KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGY
PQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacatgatggagacggagctgaagccgccgggcccgcagcaaacttcggggggc
ggcggcggcaactccaccgcggcggcggccggcggcaaccagaaaaacagcccggaccgc
gtcaagcggcccatgaatgccttcatggtgtggtcccgcgggcagcggcgcaagatggcc
caggagaaccccaagatgcacaactcggagatcagcaagcgcctgggcgccgagtggaaa
cttttgtcggagacggagaagcggccgttcatcgacgaggctaagcggctgcgagcgctg
cacatgaaggagcacccggattataaataccggccccggcggaaaaccaagacgctcatg
aagaaggataagtacacgctgcccggcgggctgctggcccccggcggcaatagcatggcg
agcggggtcggggtgggcgccggcctgggcgcgggcgtgaaccagcgcatggacagttac
gcgcacatgaacggctggagcaacggcagctacagcatgatgcaggaccagctgggctac
ccgcagcacccgggcctcaatgcgcacggcgcagcgcagatgcagcccatgcaccgctac
gacgtgagcgccctgcagtacaactccatgaccagctcgcagacctacatgaacggctcg
cccacctacagcatgtcctactcgcagcagggcacccctggcatggctcttggctccatg
ggttcggtggtcaagtccgaggccagctccagcccccctgtggttacctcttcctcccac
tccagggcgccctgccaggccggggacctccgggacatgatcagcatgtatctccccggc
gccgaggtgccggaacccgccgcccccagcagacttcacatgtcccagcactaccagagc
ggcccggtgcccggcacggccattaacggcacactgcccctctcacacatgtga

DBGET integrated database retrieval system