KEGG   Homo sapiens (human): 671Help
Entry
671               CDS       T01001                                 

Gene name
BPI, BPIFD1, rBPI
Definition
bactericidal/permeability-increasing protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.23
AA seq 487 aa AA seqDB search
MRENMARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKEL
KRIKIPDYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISG
KWKAQKRFLKMSGNFDLSIEGMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKS
KVGWLIQLFHKKIESALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGINYGL
VAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLV
YQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQ
PTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLF
GADVVYK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagagagaacatggccaggggcccttgcaacgcgccgagatgggcgtccctgatggtg
ctggtcgccataggcaccgccgtgacagcggccgtcaaccctggcgtcgtggtcaggatc
tcccagaagggcctggactacgccagccagcaggggacggccgctctgcagaaggagctg
aagaggatcaagattcctgactactcagacagctttaagatcaagcatcttgggaagggg
cattatagcttctacagcatggacatccgtgaattccagcttcccagttcccagataagc
atggtgcccaatgtgggccttaagttctccatcagcaacgccaatatcaagatcagcggg
aaatggaaggcacaaaagagattcttaaaaatgagcggcaattttgacctgagcatagaa
ggcatgtccatttcggctgatctgaagctgggcagtaaccccacgtcaggcaagcccacc
atcacctgctccagctgcagcagccacatcaacagtgtccacgtgcacatctcaaagagc
aaagtggggtggctgatccaactcttccacaaaaaaattgagtctgcgcttcgaaacaag
atgaacagccaggtctgcgagaaagtgaccaattctgtatcctccgagctgcaaccttat
ttccagactctgccagtaatgaccaaaatagattctgtggctggaatcaactatggtctg
gtggcacctccagcaaccacggctgagaccctggatgtacagatgaagggggagttttac
agtgagaaccaccacaatccacctccctttgctccaccagtgatggagtttcccgctgcc
catgaccgcatggtatacctgggcctctcagactacttcttcaacacagccgggcttgta
taccaagaggctggggtcttgaagatgacccttagagatgacatgattccaaaggagtcc
aaatttcgactgacaaccaagttctttggaaccttcctacctgaggtggccaagaagttt
cccaacatgaagatacagatccatgtctcagcctccaccccgccacacctgtctgtgcag
cccaccggccttaccttctaccctgccgtggatgtccaggcctttgccgtcctccccaac
tcctccctggcttccctcttcctgattggcatgcacacaactggttccatggaggtcagc
gccgagtccaacaggcttgttggagagctcaagctggataggctgctcctggaactgaag
cactcaaatattggccccttcccggttgaattgctgcaggatatcatgaactacattgta
cccattcttgtgctgcccagggttaacgagaaactacagaaaggcttccctctcccgacg
ccggccagagtccagctctacaacgtagtgcttcagcctcaccagaacttcctgctgttc
ggtgcagacgttgtctataaatga

DBGET integrated database retrieval system