KEGG   Homo sapiens (human): 6721Help
Entry
6721              CDS       T01001                                 

Gene name
SREBF2, SREBP-2, SREBP2, bHLHd2
Definition
(RefSeq) sterol regulatory element binding transcription factor 2
  KO
K09107  
sterol regulatory element-binding transcription factor 2
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    6721 (SREBF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13
AA seq 1141 aa AA seqDB search
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS
GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS
VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV
LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP
VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT
TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT
DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK
IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS
RILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLL
LWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC
LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAK
TSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTA
AMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSA
AKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY
LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSG
ATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRR
LAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRER
ATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAA
S
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggacgacagcggcgagctgggtggtctggagaccatggagaccctcacggagctgggc
gacgagctgaccctgggagacatcgacgagatgctgcaatttgtcagtaatcaagtggga
gagttccctgacttgttttcagaacagctgtgtagctcctttcctggcagtggtggtagt
ggtagcagcagcggcagcagtggcagcagcagcagcagcagcaatggcaggggcagcagc
agcggagctgtggacccttcagtgcaacggtcattcacccaggtcacattaccttccttc
tctccctcggcggcctccccacaggctccaactctgcaagtcaaggtttctcccacctca
gttcccaccacacccagggcaactcctattcttcagccccgcccccagccccagcctcaa
cctcaaactcagctgcaacaacagacggtaatgatcacgccaacattcagcaccactccg
cagacgaggatcatccagcagcctttgatataccagaatgcagctactagctttcaagtc
cttcagcctcaagtccaaagcctggtgacatcctcccaggtacagccggtcaccattcag
cagcaggtgcagacagtacaggcccagcgggtgctgacacaaacggccaatggcacgctg
cagacccttgccccggctacggtgcagacagttgctgcgccacaggtgcagcaggtcccg
gtcctggtccagcctcagatcatcaagacagattcccttgttttgaccacactgaagaca
gatggcagccctgttatggctgcggtccagaacccggccctcaccgccctcaccacccct
atccagacggctgcccttcaagtaccaaccctggtgggcagcagtgggaccattctgacc
acaatgcctgtaatgatggggcaagagaaagtgcccattaagcaggtacctgggggagtc
aagcagcttgagccccccaaagaaggagaaaggcggacaacccataatatcattgagaaa
cgatatcgctcctccatcaatgacaaaatcatcgaattgaaagacctggtcatggggaca
gacgccaagatgcacaagtctggcgttctgaggaaggccattgattacatcaaatacttg
cagcaggtcaatcataaactgcgccaggagaacatggtgctgaagctggcaaatcaaaag
aacaagcttctaaagggcatcgacctaggcagtctggtggacaatgaggtggacctgaag
atcgaggactttaatcagaatgtccttctgatgtcccccccagcctctgactcagggtcc
caggctggcttctctccctactccattgactctgagccaggaagccctctattggatgat
gcaaaggtcaaagatgagccagactctcctcctgtggcgctgggcatggtagaccgctca
cggattcttctgtgtgtcctcaccttcctgtgcctctcctttaaccccctgacttccctg
ctgcagtggggaggggcccacgactctgaccagcacccacactcaggctctggccgcagt
gtcctgtcattcgagtcaggttctgggggctggtttgactggatgatgcctactcttctc
ttatggctggtaaatggtgtgattgtcctgagcgtctttgtgaagctgctggttcatggg
gagccagtgatccggccacactcgcgctcctcggtcaccttctggaggcaccggaaacag
gcagatctggatctcgccagaggagattttgcagctgctgccggcaacctacaaacctgc
ctggcagttttgggccgggcactgcccacctcccgcctggacctggcctgcagcctctcc
tggaacgtgatccgctacagcctgcagaagctacgcctggtgcgctggctgctcaagaaa
gtcttccagtgccggcgggccacgccagccactgaggcaggctttgaagacgaagctaag
accagcgcccgggatgcggctctggcctatcaccggctgcaccagctgcacatcacaggg
aagcttcctgcaggatccgcctgttccgatgtacacatggcgttgtgtgccgtgaacctg
gctgaatgtgcagaggagaagatcccaccgagcacactggttgagatccatctgactgct
gccatggggctcaagacccggtgtggaggcaagctgggcttcctggccagctacttcctc
agccgagcccagagcctgtgtggccccgagcacagtgctgttcctgactccctgcgctgg
ctctgccaccccctgggccagaagtttttcatggagcggagctggtctgtgaagtcagct
gccaaggagagtctatactgtgcccagaggaacccagctgaccccattgcgcaggtccac
caggccttctgcaagaacctgctggagcgagctatagagtccttggtgaaacctcaggcc
aagaagaaggctggagaccaggaagaagagagctgtgaattctccagtgctctggagtac
ttgaaattacttcattcttttgtggactctgtgggggttatgagccccccactctccagg
agctccgtgctcaagtccgccctgggtccagacatcatctgtcggtggtggacgtctgca
atcactgtggccatcagctggctccagggagacgatgcagctgtgcgctctcattttacc
aaagtggaacgcatccccaaggccctggaagtgacagagagccccctggtgaaggccatc
ttccatgcctgcagagccatgcatgcctcactccctgggaaagcagatgggcagcagagt
tccttctgccattgcgagagggccagtggccacctatggagcagcctcaacgtcagtggg
gccacctctgaccctgccctcaaccacgtggtccagctgctcacctgtgacctgctactg
tcgctacggacagcgctctggcaaaaacaggccagtgccagccaggctgtgggggagacc
taccacgcgtcaggcgctgaactggcgggcttccaacgggacctgggcagcctgcgcagg
ctggcacacagcttccgcccagcataccgcaaggtgttcctgcatgaagccaccgtgcgc
ctgatggcaggagccagccccacccgcacccaccagctgctggaacacagcctgcggcgg
cgcaccacgcagagcaccaagcacggagaggtggatgcctggcccggccagcgagagcgg
gccaccgccatcctgctggcctgccgccacctgcccctctccttcctctcctccccgggc
cagcgggcagtgctgctggccgaagctgcccgcaccctggagaaggtgggcgaccggcgc
tcctgcaacgactgccagcagatgattgttaagctgggtggtggcactgccattgccgcc
tcctga

DBGET integrated database retrieval system