KEGG   Homo sapiens (human): 6736Help
Entry
6736              CDS       T01001                                 

Gene name
SRY, SRXX1, SRXY1, TDF, TDY
Definition
sex determining region Y
Orthology
K09266  
sex-determining region Y protein (SOX group A)
Organism
hsa  Homo sapiens (human)
Disease
H00598  
46,XX disorders of sex development (Disorders of gonadal development)
H00607  
46,XY disorders of sex development (Disorders of gonadal development)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    6736 (SRY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
Yp11.3
AA seq 204 aa AA seqDB search
MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
GHLPPINAASSPQQRDRYSHWTKL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatatgcttctgctatgttaagcgtattcaacagcgatgattacagtccagct
gtgcaagagaatattcccgctctccggagaagctcttccttcctttgcactgaaagctgt
aactctaagtatcagtgtgaaacgggagaaaacagtaaaggcaacgtccaggatagagtg
aagcgacccatgaacgcattcatcgtgtggtctcgcgatcagaggcgcaagatggctcta
gagaatcccagaatgcgaaactcagagatcagcaagcagctgggataccagtggaaaatg
cttactgaagccgaaaaatggccattcttccaggaggcacagaaattacaggccatgcac
agagagaaatacccgaattataagtatcgacctcgtcggaaggcgaagatgctgccgaag
aattgcagtttgcttcccgcagatcccgcttcggtactctgcagcgaagtgcaactggac
aacaggttgtacagggatgactgtacgaaagccacacactcaagaatggagcaccagcta
ggccacttaccgcccatcaacgcagccagctcaccgcagcaacgggaccgctacagccac
tggacaaagctgtag

DBGET integrated database retrieval system