KEGG   Homo sapiens (human): 6736Help
Entry
6736              CDS       T01001                                 

Gene name
SRY, SRXX1, SRXY1, TDF, TDY
Definition
(RefSeq) sex determining region Y
  KO
K09266  sex-determining region Y protein (SOX group A)
Organism
hsa  Homo sapiens (human)
Disease
H00598  46,XX disorders of sex development (Disorders of gonadal development)
H00607  46,XY disorders of sex development (Disorders of gonadal development)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    6736 (SRY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 DUF1908
Motif
Other DBs
NCBI-GeneID: 6736
NCBI-ProteinID: NP_003131
OMIM: 480000
HGNC: 11311
Ensembl: ENSG00000184895
Vega: OTTHUMG00000036084
Pharos: Q05066(Tbio)
UniProt: Q05066 A7WPU8
Structure
PDB: 

Jmol
Position
Yp11.2
AA seq 204 aa AA seqDB search
MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
GHLPPINAASSPQQRDRYSHWTKL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatatgcttctgctatgttaagcgtattcaacagcgatgattacagtccagct
gtgcaagagaatattcccgctctccggagaagctcttccttcctttgcactgaaagctgt
aactctaagtatcagtgtgaaacgggagaaaacagtaaaggcaacgtccaggatagagtg
aagcgacccatgaacgcattcatcgtgtggtctcgcgatcagaggcgcaagatggctcta
gagaatcccagaatgcgaaactcagagatcagcaagcagctgggataccagtggaaaatg
cttactgaagccgaaaaatggccattcttccaggaggcacagaaattacaggccatgcac
agagagaaatacccgaattataagtatcgacctcgtcggaaggcgaagatgctgccgaag
aattgcagtttgcttcccgcagatcccgcttcggtactctgcagcgaagtgcaactggac
aacaggttgtacagggatgactgtacgaaagccacacactcaagaatggagcaccagcta
ggccacttaccgcccatcaacgcagccagctcaccgcagcaacgggaccgctacagccac
tggacaaagctgtag

DBGET integrated database retrieval system