KEGG   Homo sapiens (human): 6785Help
Entry
6785              CDS       T01001                                 

Gene name
ELOVL4, ADMD, CT118, ISQMR, STGD2, STGD3
Definition
ELOVL fatty acid elongase 4 (EC:2.3.1.199)
Orthology
K10249  
elongation of very long chain fatty acids protein 4 [EC:2.3.1.199]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Module
Fatty acid biosynthesis, elongation, endoplasmic reticulum
Disease
H00819  
Stargardt disease (STGD)
Class
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hsa00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q14
AA seq 314 aa AA seqDB search
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV
WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVH
EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ
AFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTD
CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMI
ENGKKQKNGKAKGD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggggctcctggactcggagccgggtagtgtcctaaacgtagtgtccacggcactcaac
gacacggtagagttctaccgctggacctggtccatcgcagataagcgtgtggaaaattgg
cctctgatgcagtctccttggcctacactaagtataagcactctttatctcctgtttgtg
tggctgggtccaaaatggatgaaggaccgagaaccttttcagatgcgtctagtgctcatt
atctataattttgggatggttttgcttaacctctttatcttcagagagttattcatggga
tcatataatgcgggatatagctatatttgccagagtgtggattattctaataatgttcat
gaagtcaggatagctgctgctctgtggtggtactttgtatctaaaggagttgagtatttg
gacacagtgttttttattctgagaaagaaaaacaaccaagtttctttccttcatgtgtat
catcactgtacgatgtttaccttgtggtggattggaattaagtgggttgcaggaggacaa
gcattttttggagcccagttgaattcctttatccatgtgattatgtactcatactatggg
ttaactgcatttggcccatggattcagaaatatctttggtggaaacgatacctgactatg
ttgcaactgattcaattccatgtgaccattgggcacacggcactgtctctttacactgac
tgccccttccccaaatggatgcactgggctctaattgcctatgcaatcagcttcatattt
ctctttcttaacttctacattcggacatacaaagagcctaagaaaccaaaagctggaaaa
acagccatgaatggtatttcagcaaatggtgtgagcaaatcagaaaaacaactcatgata
gaaaatggaaaaaagcagaaaaatggaaaagcaaaaggagattaa

DBGET integrated database retrieval system