KEGG   Homo sapiens (human): 6834Help
Entry
6834              CDS       T01001                                 

Gene name
SURF1, CMT4K
Definition
(RefSeq) surfeit 1 (EC:1.9.3.1)
  KO
K14998  
surfeit locus 1 family protein
Organism
hsa  Homo sapiens (human)
Disease
H01354  
Leigh syndrome
H01368  
Cytochrome c oxidase (COX) deficiency
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    6834 (SURF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.2
AA seq 300 aa AA seqDB search
MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAEASATKAEDDS
FLQWVLLLIPVTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPV
KVRGCFDHSKELYMMPRTMVDPVREAREGGLISSSTQSGAYVVTPFHCTDLGVTILVNRG
FVPRKKVNPETRQKGQIEGEVDLIGMVRLTETRQPFVPENNPERNHWHYRDLEAMARITG
AEPIFIDANFQSTVPGGPIGGQTRVTLRNEHLQYIVTWYGLSAATSYLWFKKFLRGTPGV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggctgcgttgcagctggggctgcgggcggcggggctgggacgggccccg
gccagcgccgcctggaggagcgtcctcagggtctccccgcgcccaggggtggcctggagg
ccaagcagatgtggcagttctgcagcagaagcatctgccacaaaagcggaagatgactcc
tttcttcagtgggtcctgctcctcatccctgtgactgcctttggcttggggacatggcag
gtccagcgtcggaagtggaagctgaacctgattgcagagttggagtccagagttctggct
gagcctgtccctctgccagccgacccaatggaactgaaaaatctggagtataggccagtg
aaggtcagggggtgctttgaccattccaaggagctgtatatgatgccccggaccatggtg
gaccctgtccgggaggcccgggagggcggcctcatctcctcctcaactcagagtggggcc
tatgtggtcactcccttccactgcaccgacctgggagtcaccatcctggtaaatagaggg
ttcgttcccaggaagaaagtgaatcctgaaacccggcagaaaggccagattgagggagaa
gtggacctcattgggatggtgaggctgacagaaaccaggcagccttttgtccctgagaac
aatccagaaaggaaccactggcattatcgagacctggaagctatggccagaatcacaggc
gcagagcccatcttcattgatgccaacttccagagcacagtccctggaggacccattgga
gggcaaaccagagttactctgaggaacgagcatctgcagtacatcgtgacctggtatgga
ctctctgcagctacatcctacctgtggtttaagaaattcctacgtgggacacctggtgtg
tga

DBGET integrated database retrieval system