KEGG   Homo sapiens (human): 6862Help
Entry
6862              CDS       T01001                                 

Gene name
TBXT, SAVA, T, TFT
Definition
(RefSeq) T-box transcription factor T
  KO
K10172  brachyury protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   T-box
    6862 (TBXT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 6862
NCBI-ProteinID: NP_003172
OMIM: 601397
HGNC: 11515
Ensembl: ENSG00000164458
Vega: OTTHUMG00000015991
Pharos: O15178(Tbio)
UniProt: O15178
Structure
PDB: 

Jmol
Position
6q27
AA seq 435 aa AA seqDB search
MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGDSQQPG
YSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNS
PTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTP
GSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQ
GRLIASWTPVSPPSM
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccctggcaccgagagcgcgggaaagagcctgcagtaccgagtggaccacctg
ctgagcgccgtggagaatgagctgcaggcgggcagcgagaagggcgaccccacagagcgc
gaactgcgcgtgggcctggaggagagcgagctgtggctgcgcttcaaggagctcaccaat
gagatgatcgtgaccaagaacggcaggaggatgtttccggtgctgaaggtgaacgtgtct
ggcctggaccccaacgccatgtactccttcctgctggacttcgtggcggcggacaaccac
cgctggaagtacgtgaacggggaatgggtgccggggggcaagccggagccgcaggcgccc
agctgcgtctacatccaccccgactcgcccaacttcggggcccactggatgaaggctccc
gtctccttcagcaaagtcaagctcaccaacaagctcaacggagggggccagatcatgctg
aactccttgcataagtatgagcctcgaatccacatagtgagagttgggggtccacagcgc
atgatcaccagccactgcttccctgagacccagttcatagcggtgactgcttatcagaac
gaggagatcacagctcttaaaattaagtacaatccatttgcaaaagctttccttgatgca
aaggaaagaagtgatcacaaagagatgatggaggaacccggagacagccagcaacctggg
tactcccaatgggggtggcttcttcctggaaccagcaccctgtgtccacctgcaaatcct
catcctcagtttggaggtgccctctccctcccctccacgcacagctgtgacaggtaccca
accctgaggagccaccggtcctcaccctaccccagcccctatgctcatcggaacaattct
ccaacctattctgacaactcacctgcatgtttatccatgctgcaatcccatgacaattgg
tccagccttggaatgcctgcccatcccagcatgctccccgtgagccacaatgccagccca
cctaccagctccagtcagtaccccagcctgtggtctgtgagcaacggcgccgtcaccccg
ggctcccaggcagcagccgtgtccaacgggctgggggcccagttcttccggggctccccc
gcgcactacacacccctcacccatccggtctcggcgccctcttcctcgggatccccactg
tacgaaggggcggccgcggccacagacatcgtggacagccagtacgacgccgcagcccaa
ggccgcctcatagcctcatggacacctgtgtcgccaccttccatgtga

DBGET integrated database retrieval system