KEGG   Homo sapiens (human): 6862Help
Entry
6862              CDS       T01001                                 

Gene name
T, SAVA, TFT
Definition
T, brachyury homolog (mouse)
Orthology
K10172  
brachyury protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   T-box
    6862 (T)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q27
AA seq 377 aa AA seqDB search
MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGDSQQPG
YSQSYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAV
TPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAA
AQGRLIASWTPVSPPSM
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccctggcaccgagagcgcgggaaagagcctgcagtaccgagtggaccacctg
ctgagcgccgtggagaatgagctgcaggcgggcagcgagaagggcgaccccacagagcgc
gaactgcgcgtgggcctggaggagagcgagctgtggctgcgcttcaaggagctcaccaat
gagatgatcgtgaccaagaacggcaggaggatgtttccggtgctgaaggtgaacgtgtct
ggcctggaccccaacgccatgtactccttcctgctggacttcgtggcggcggacaaccac
cgctggaagtacgtgaacggggaatgggtgccggggggcaagccggagccgcaggcgccc
agctgcgtctacatccaccccgactcgcccaacttcggggcccactggatgaaggctccc
gtctccttcagcaaagtcaagctcaccaacaagctcaacggagggggccagatcatgctg
aactccttgcataagtatgagcctcgaatccacatagtgagagttgggggtccacagcgc
atgatcaccagccactgcttccctgagacccagttcatagcggtgactgcttatcagaac
gaggagatcacagctcttaaaattaagtacaatccatttgcaaaagctttccttgatgca
aaggaaagaagtgatcacaaagagatgatggaggaacccggagacagccagcaacctggg
tactcccaatcctattctgacaactcacctgcatgtttatccatgctgcaatcccatgac
aattggtccagccttggaatgcctgcccatcccagcatgctccccgtgagccacaatgcc
agcccacctaccagctccagtcagtaccccagcctgtggtctgtgagcaacggcgccgtc
accccgggctcccaggcagcagccgtgtccaacgggctgggggcccagttcttccggggc
tcccccgcgcactacacacccctcacccatccggtctcggcgccctcttcctcgggatcc
ccactgtacgaaggggcggccgcggccacagacatcgtggacagccagtacgacgccgca
gcccaaggccgcctcatagcctcatggacacctgtgtcgccaccttccatgtga

DBGET integrated database retrieval system