KEGG   Homo sapiens (human): 6872Help
Entry
6872              CDS       T01001                                 

Gene name
TAF1, BA2R, CCG1, CCGS, DYT3, DYT3/TAF1, KAT4, MRXS33, N-TAF1, NSCL2, OF, P250, TAF(II)250, TAF2A, TAFII-250, TAFII250, XDP
Definition
(RefSeq) TATA-box binding protein associated factor 1 (EC:2.3.1.48 2.7.11.1)
  KO
K03125  
transcription initiation factor TFIID subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Disease
H00831  
Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    6872 (TAF1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  TAF1 family
   6872 (TAF1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6872 (TAF1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    6872 (TAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq13.1
AA seq 1872 aa AA seqDB search
MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDD
ECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDE
SRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKV
DFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLR
FLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPP
PPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGS
GFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGED
VKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRW
EDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRI
LLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQ
PFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGG
EMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYG
ETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIF
VVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSES
SIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKD
AGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCG
EGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKL
SRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSST
EVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAA
SGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTT
KDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDL
KLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEG
TKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTD
PMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYP
SREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLD
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKH
KYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICT
AKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSAT
PEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSA
IQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISY
GSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFH
SIAGDSDLDSDE
NT seq 5619 nt NT seq  +upstreamnt  +downstreamnt
atgggacccggctgcgatttgctgctgcggacagcagctaccatcactgctgccgccatc
atgtcagacacggacagcgacgaagattccgctggaggcggcccattttctttagcgggt
ttccttttcggcaacatcaatggagccgggcagctggagggggaaagcgtcttggatgat
gaatgtaagaagcacttggcaggcttgggggctttggggctgggcagcctgatcactgaa
ctcacggcaaatgaagaattgaccgggactgacggtgccttggtaaatgatgaagggtgg
gttaggagtacagaagatgctgtggactattcagacatcaatgaggtggcagaagatgaa
agccgaagataccagcagacgatggggagcttgcagcccctttgccactcagattatgat
gaagatgactatgatgctgattgtgaagacattgattgcaagttgatgcctcctccacct
ccacccccgggaccaatgaagaaggataaggaccaggattctattactggtgagaaagtg
gacttcagtagttcctctgactcagaatctgagatgggacctcaggaagcaacacaggca
gaatctgaagatggaaagctgacccttccattggctgggattatgcagcatgatgccacc
aagctgttgccaagtgtcacagaactttttccagaatttcgacctggaaaggtgttacgt
tttctacgtctttttggaccagggaagaatgtcccatctgtttggcggagtgctcggaga
aagaggaagaagaagcaccgtgagctgatacaggaagagcagatccaggaggtggagtgc
tcagtagaatcagaagtcagccagaagtctttgtggaactacgactacgctccaccacca
cctccagagcagtgtctctctgatgatgaaatcacgatgatggctcctgtggagtccaaa
ttttcccaatcaactggagatatagataaagtgacagataccaaaccaagagtggctgag
tggcgttatgggcctgcccgactgtggtatgatatgctgggtgtccctgaagatggcagt
gggtttgactatggcttcaaactgagaaagacagaacatgaacctgtgataaaatctaga
atgatagaggaatttaggaaacttgaggaaaacaatggcactgatcttctggctgatgaa
aacttcctgatggtgacacagctgcattgggaggatgatatcatctgggatggggaggat
gtcaaacacaaagggacaaaacctcagcgtgcaagcctggcaggctggcttccttctagc
atgactaggaatgcgatggcttacaatgttcagcaaggttttgcagccactcttgatgat
gacaaaccttggtactccatttttcccattgacaatgaggatctggtatatggacgctgg
gaggacaatatcatttgggatgctcaggccatgccccggctgttggaacctcctgttttg
acacttgatcccaatgatgagaacctcattttggaaattcctgatgagaaggaagaggcc
acctctaactccccctccaaggagagtaagaaggaatcatctctgaagaagagtcgaatt
ctcttagggaaaacaggagtcatcaaggaggaaccacagcagaacatgtctcagccagaa
gtgaaagatccatggaatctctccaatgatgagtattattatcccaagcaacagggtctt
cgaggcacctttggagggaatattatccagcattcaattcctgctgtggaattacggcag
cccttctttcccacccacatggggcccatcaaactccggcagttccatcgcccacctctg
aaaaagtactcatttggtgcactttctcagccaggtccccactcagtccaacctttgcta
aagcacatcaaaaaaaaggccaagatgagagaacaagagaggcaagcttcaggtggtgga
gagatgttttttatgcgcacacctcaggacctcacaggcaaagatggtgatcttattctt
gcagaatatagtgaggaaaatggacccttaatgatgcaggttggcatggcaaccaagata
aagaactattataaacggaaacctggaaaagatcctggagcaccagattgtaaatatggg
gaaactgtttactgccatacatctcctttcctgggttctctccatcctggccaattgctg
caagcatttgagaacaacctttttcgtgctccaatttatcttcataagatgccagaaact
gatttcttgatcattcggacaagacagggttactatattcgggaattagtggatattttt
gtggttggccagcagtgtcccttgtttgaagttcctgggcctaactccaaaagggccaat
acgcatattcgagactttctacaggtttttatttaccgccttttctggaaaagtaaagat
cggccacggaggatacgaatggaagatataaaaaaagcctttccttcccattcagaaagc
agcatccggaagaggctaaagctctgcgctgacttcaaacgcacagggatggactcaaac
tggtgggtgcttaagtctgattttcgtttaccaacggaagaagagatcagagctatggtg
tcaccagagcagtgctgtgcttattatagcatgatagctgcagagcaacgactgaaggat
gctggctatggtgagaaatccttttttgctccagaagaagaaaatgaggaagatttccag
atgaagattgatgatgaagttcgcactgccccttggaacaccacaagggccttcattgct
gccatgaagggcaagtgtctgctagaggtgactggggtggcagatcccacggggtgtggt
gaaggattctcctatgtgaagattccaaacaaaccaacacagcagaaggatgataaagaa
ccgcagccagtgaagaagacagtgacaggaacagatgcagaccttcgtcgcctttccctg
aaaaatgccaagcaacttctacgtaaatttggtgtgcctgaggaagagattaaaaagttg
tcccgctgggaagtgattgatgtggtgcgcacaatgtcaacagaacaggctcgttctgga
gaggggcccatgagtaaatttgcccgtggatcaaggttttctgtggctgagcatcaagag
cgttacaaagaggaatgtcagcgcatctttgacctacagaacaaggttctgtcatcaact
gaagtcttatcaactgacacagacagcagctcagctgaagatagtgactttgaagaaatg
ggaaagaacattgagaacatgttgcagaacaagaaaaccagctctcagctttcacgtgaa
cgggaggaacaggagcggaaggaactacagcgaatgctactggcagcaggctcagcagca
tccggaaacaatcacagagatgatgacacagcttccgtgactagccttaactcttctgcc
actggacgctgtctcaagatttatcgcacgtttcgagatgaagaggggaaagagtatgtt
cgctgtgagacagtccgaaaaccagctgtcattgatgcctatgtgcgcatacggactaca
aaagatgaggaattcattcgaaaatttgccctttttgatgaacaacatcgggaagagatg
cgaaaagaacggcggaggattcaagagcaactgaggcggcttaagaggaaccaggaaaag
gagaagcttaagggtcctcctgagaagaagcccaagaaaatgaaggagcgtcctgaccta
aaactgaaatgtggggcatgtggtgccattggacacatgaggactaacaaattctgcccc
ctctattatcaaacaaatgcgccaccttccaaccctgttgccatgacagaagaacaggag
gaggagttggaaaagacagtcattcataatgataatgaagaacttatcaaggttgaaggg
accaaaattgtcttggggaaacagctaattgagagtgcggatgaggttcgcagaaaatct
ctggttctcaagtttcctaaacagcagcttcctccaaagaagaaacggcgagttggaacc
actgttcactgtgactatttgaatagacctcataagtccatccaccggcgccgcacagac
cctatggtgacgctgtcgtccatcttggagtctatcatcaatgacatgagagatcttcca
aatacataccctttccacactccagtcaatgcaaaggttgtaaaggactactacaaaatc
atcactcggccaatggacctacaaacactccgcgaaaacgtgcgtaaacgcctctaccca
tctcgggaagagttcagagagcatctggagctaattgtgaaaaatagtgcaacctacaat
gggccaaaacactcattgactcagatctctcaatccatgctggatctctgtgatgaaaaa
ctcaaagagaaagaagacaaattagctcgcttagagaaagctatcaaccccttgctggat
gatgatgaccaagtggcgttttctttcattctggacaacattgtcacccagaaaatgatg
gcagttccagattcttggccatttcatcacccagttaataagaaatttgttccagattat
tacaaagtgattgtcaatccaatggatttagagaccatacgtaagaacatctccaagcac
aagtatcagagtcgggagagctttctggatgatgtaaaccttattctggccaacagtgtt
aagtataatggacctgagagtcagtatactaagactgcccaggagattgtgaacgtctgt
taccagacattgactgagtatgatgaacatttgactcaacttgagaaggatatttgtact
gctaaagaagcagctttggaggaagcagaattagaaagcctggacccaatgaccccaggg
ccctacacgcctcagcctcctgatttgtatgataccaacacatccctcagtatgtctcga
gatgcctctgtatttcaagatgagagcaatatgtctgtcttggatattcccagtgccact
ccagaaaagcaggtaacacaggaaggtgaagatggagatggtgatcttgcagatgaagag
gaaggaactgtacaacagcctcaagccagtgtcctgtatgaggatttgcttatgtctgaa
ggagaagatgatgaggaagatgctgggagtgatgaagaaggagacaatcctttctctgct
atccagctgagtgaaagtggaagtgactctgatgtgggatctggtggaataagacccaaa
caaccccgcatgcttcaggagaacacaaggatggacatggaaaatgaagaaagcatgatg
tcctatgagggagacggtggggaggcttcccatggtttggaggatagcaacatcagttat
gggagctatgaggagcctgatcccaagtcgaacacccaagacacaagcttcagcagcatc
ggtgggtatgaggtatcagaggaggaagaagatgaggaggaggaagagcagcgctctggg
ccgagcgtactaagccaggtccacctgtcagaggacgaggaggacagtgaggatttccac
tccattgctggggacagtgacttggactctgatgaatga

DBGET integrated database retrieval system