KEGG   Homo sapiens (human): 6880Help
Entry
6880              CDS       T01001                                 

Gene name
TAF9, MGC:5067, STAF31/32, TAF2G, TAFII-31, TAFII-32, TAFII31, TAFII32, TAFIID32
Definition
(RefSeq) TATA-box binding protein associated factor 9
  KO
K14535  transcription initiation factor TFIID subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    6880 (TAF9)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6880 (TAF9)
   Coactivators
    SAGA/TFTC/STAGA complex
     6880 (TAF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIID-31kDa CENP-S Bromo_TP Histone CENP-T_C CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 6880
NCBI-ProteinID: NP_001015892
OMIM: 600822
HGNC: 11542
Ensembl: ENSG00000273841
Vega: OTTHUMG00000099359
Pharos: Q16594(Tbio)
UniProt: Q16594
Position
5q13.2
AA seq 264 aa AA seqDB search
MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPM
SLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggcaagacggcttctcccaagagcatgccgaaagatgcacagatgatggca
caaatcctgaaggatatggggattacagaatatgagccaagagttataaatcagatgttg
gagtttgccttccgatatgtgaccacaattctagatgatgcaaaaatttattcaagccat
gctaagaaagctactgttgatgcagatgatgtgcgattggcaatccagtgccgcgctgat
cagtcttttacctctcctcccccaagagattttttattagatattgcaaggcaaagaaat
caaacccctttgccattgatcaagccatattcaggtcctaggttgccacctgatagatac
tgcttaacagctccaaactataggctgaaatctttacagaaaaaggcatcaacttctgcg
ggaagaataacagtcccgcggttaagtgttggttcagttactagcagaccaagtactccc
acactaggcacaccaaccccacagaccatgtctgtttcaactaaagtagggactcccatg
tccctcacaggtcaaaggtttacagtacagatgcctacttctcagtctccagctgtaaaa
gcttcaattcctgcaacctcagcagttcagaatgttctgattaatccatcattaatcggg
tccaaaaacattcttattaccactaatatgatgtcatcacaaaatactgccaatgaatca
tcaaatgcattgaaaagaaaacgtgaagatgatgatgatgacgatgatgatgatgatgac
tatgataatctgtaa

DBGET integrated database retrieval system