KEGG   Homo sapiens (human): 6880Help
Entry
6880              CDS       T01001                                 

Gene name
TAF9, MGC:5067, STAF31/32, TAF2G, TAFII-31, TAFII-32, TAFII31, TAFII32, TAFIID32
Definition
(RefSeq) TATA-box binding protein associated factor 9
  KO
K14535  
transcription initiation factor TFIID subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    6880 (TAF9)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6880 (TAF9)
   Coactivators
    SAGA/TFTC/STAGA complex
     6880 (TAF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q13.2
AA seq 264 aa AA seqDB search
MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPM
SLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggcaagacggcttctcccaagagcatgccgaaagatgcacagatgatggca
caaatcctgaaggatatggggattacagaatatgagccaagagttataaatcagatgttg
gagtttgccttccgatatgtgaccacaattctagatgatgcaaaaatttattcaagccat
gctaagaaagctactgttgatgcagatgatgtgcgattggcaatccagtgccgcgctgat
cagtcttttacctctcctcccccaagagattttttattagatattgcaaggcaaagaaat
caaacccctttgccattgatcaagccatattcaggtcctaggttgccacctgatagatac
tgcttaacagctccaaactataggctgaaatctttacagaaaaaggcatcaacttctgcg
ggaagaataacagtcccgcggttaagtgttggttcagttactagcagaccaagtactccc
acactaggcacaccaaccccacagaccatgtctgtttcaactaaagtagggactcccatg
tccctcacaggtcaaaggtttacagtacagatgcctacttctcagtctccagctgtaaaa
gcttcaattcctgcaacctcagcagttcagaatgttctgattaatccatcattaatcggg
tccaaaaacattcttattaccactaatatgatgtcatcacaaaatactgccaatgaatca
tcaaatgcattgaaaagaaaacgtgaagatgatgatgatgacgatgatgatgatgatgac
tatgataatctgtaa

DBGET integrated database retrieval system