KEGG   Homo sapiens (human): 6925Help
Entry
6925              CDS       T01001                                 

Gene name
TCF4, E2-2, ITF-2, ITF2, PTHS, SEF-2, SEF2, SEF2-1, SEF2-1A, SEF2-1B, SEF2-1D, TCF-4, bHLHb19
Definition
transcription factor 4
Orthology
K15603  
transcription factor 4/12
Organism
hsa  Homo sapiens (human)
Disease
H00756  
Pitt-Hopkins syndrome
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Ubiquitous (class A) factors
    6925 (TCF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 671 aa AA seqDB search
MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG
NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG
CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL
PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG
MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA
NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA
VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ
SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
IKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLK
SDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPG
MGDASNHMGQM
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccaacagcgaatggctgccttagggacggacaaagagctgagtgatttactg
gatttcagtgcgatgttttcacctcctgtgagcagtgggaaaaatggaccaacttctttg
gcaagtggacattttactggctcaaatgtagaagacagaagtagctcagggtcctggggg
aatggaggacatccaagcccgtccaggaactatggagatgggactccctatgaccacatg
accagcagggaccttgggtcacatgacaatctctctccaccttttgtcaattccagaata
caaagtaaaacagaaaggggctcatactcatcttatgggagagaatcaaacttacagggt
tgccaccagcagagtctccttggaggtgacatggatatgggcaacccaggaaccctttcg
cccaccaaacctggttcccagtactatcagtattctagcaataatccccgaaggaggcct
cttcacagtagtgccatggaggtacagacaaagaaagttcgaaaagttcctccaggtttg
ccatcttcagtctatgctccatcagcaagcactgccgactacaatagggactcgccaggc
tatccttcctccaaaccagcaaccagcactttccctagctccttcttcatgcaagatggc
catcacagcagtgacccttggagctcctccagtgggatgaatcagcctggctatgcagga
atgttgggcaactcttctcatattccacagtccagcagctactgtagcctgcatccacat
gaacgtttgagctatccatcacactcctcagcagacatcaattccagtcttcctccgatg
tccactttccatcgtagtggtacaaaccattacagcacctcttcctgtacgcctcctgcc
aacgggacagacagtataatggcaaatagaggaagcggggcagccggcagctcccagact
ggagatgctctggggaaagcacttgcttcgatctattctccagatcacactaacaacagc
ttttcatcaaacccttcaactcctgttggctctcctccatctctctcagcaggcacagct
gtttggtctagaaatggaggacaggcctcatcgtctcctaattatgaaggacccttacac
tctttgcaaagccgaattgaagatcgtttagaaagactggatgatgctattcatgttctc
cggaaccatgcagtgggcccatccacagctatgcctggtggtcatggggacatgcatgga
atcattggaccttctcataatggagccatgggtggtctgggctcagggtatggaaccggc
cttctttcagccaacagacattcactcatggtggggacccatcgtgaagatggcgtggcc
ctgagaggcagccattctcttctgccaaaccaggttccggttccacagcttcctgtccag
tctgcgacttcccctgacctgaacccaccccaggacccttacagaggcatgccaccagga
ctacaggggcagagtgtctcctctggcagctctgagatcaaatccgatgacgagggtgat
gagaacctgcaagacacgaaatcttcggaggacaagaaattagatgacgacaagaaggat
atcaaatcaattactaggtcaagatctagcaataatgacgatgaggacctgacaccagag
cagaaggcagagcgtgagaaggagcggaggatggccaacaatgcccgagagcgtctgcgg
gtccgtgacatcaacgaggctttcaaagagctcggccgcatggtgcagctccacctcaag
agtgacaagccccagaccaagctcctgatcctccaccaggcggtggccgtcatcctcagt
ctggagcagcaagtccgagaaaggaatctgaatccgaaagctgcgtgtctgaaaagaagg
gaggaagagaaggtgtcctcagagcctccccctctctccttggccggcccacaccctgga
atgggagacgcatcgaatcacatgggacagatgtaa

DBGET integrated database retrieval system