KEGG   Homo sapiens (human): 695Help
Entry
695               CDS       T01001                                 

Gene name
BTK, AGMX1, AT, ATK, BPK, IMD1, PSCTK1, XLA
Definition
Bruton agammaglobulinemia tyrosine kinase (EC:2.7.10.2)
Orthology
K07370  
Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Platelet activation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Primary immunodeficiency
Disease
H00085  
Agammaglobulinemias
H00254  
Pituitary Dwarfism (PD)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    695 (BTK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    695 (BTK)
   04662 B cell receptor signaling pathway
    695 (BTK)
   04664 Fc epsilon RI signaling pathway
    695 (BTK)
  Development
   04380 Osteoclast differentiation
    695 (BTK)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    695 (BTK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     695 (BTK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Tec family [OT]
   695 (BTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq21.33-q22
AA seq 659 aa AA seqDB search
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagtgattctggagagcatctttctgaagcgatcccaacagaaaaagaaaaca
tcacctctaaacttcaagaagcgcctgtttctcttgaccgtgcacaaactctcctactat
gagtatgactttgaacgtgggagaagaggcagtaagaagggttcaatagatgttgagaag
atcacttgtgttgaaacagtggttcctgaaaaaaatcctcctccagaaagacagattccg
agaagaggtgaagagtccagtgaaatggagcaaatttcaatcattgaaaggttcccttat
cccttccaggttgtatatgatgaagggcctctctacgtcttctccccaactgaagaacta
aggaagcggtggattcaccagctcaaaaacgtaatccggtacaacagtgatctggttcag
aaatatcacccttgcttctggatcgatgggcagtatctctgctgctctcagacagccaaa
aatgctatgggctgccaaattttggagaacaggaatggaagcttaaaacctgggagttct
caccggaagacaaaaaagcctcttcccccaacgcctgaggaggaccagatcttgaaaaag
ccactaccgcctgagccagcagcagcaccagtctccacaagtgagctgaaaaaggttgtg
gccctttatgattacatgccaatgaatgcaaatgatctacagctgcggaagggtgatgaa
tattttatcttggaggaaagcaacttaccatggtggagagcacgagataaaaatgggcag
gaaggctacattcctagtaactatgtcactgaagcagaagactccatagaaatgtatgag
tggtattccaaacacatgactcggagtcaggctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagctggcaaatatacagtgtctgtgttt
gctaaatccacaggggaccctcaaggggtgatacgtcattatgttgtgtgttccacacct
cagagccagtattacctggctgagaagcaccttttcagcaccatccctgagctcattaac
taccatcagcacaactctgcaggactcatatccaggctcaaatatccagtgtctcaacaa
aacaagaatgcaccttccactgcaggcctgggatacggatcatgggaaattgatccaaag
gacctgaccttcttgaaggagctggggactggacaatttggggtagtgaagtatgggaaa
tggagaggccagtacgacgtggccatcaagatgatcaaagaaggctccatgtctgaagat
gaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggcgtctgcaccaagcagcgccccatcttcatcatcactgagtacatggccaatggc
tgcctcctgaactacctgagggagatgcgccaccgcttccagactcagcagctgctagag
atgtgcaaggatgtctgtgaagccatggaatacctggagtcaaagcagttccttcaccga
gacctggcagctcgaaactgtttggtaaacgatcaaggagttgttaaagtatctgatttc
ggcctgtccaggtatgtcctggatgatgaatacacaagctcagtaggctccaaatttcca
gtccggtggtccccaccggaagtcctgatgtatagcaagttcagcagcaaatctgacatt
tgggcttttggggttttgatgtgggaaatttactccctggggaagatgccatatgagaga
tttactaacagtgagactgctgaacacattgcccaaggcctacgtctctacaggcctcat
ctggcttcagagaaggtatataccatcatgtacagttgctggcatgagaaagcagatgag
cgtcccactttcaaaattcttctgagcaatattctagatgtcatggatgaagaatcctga

DBGET integrated database retrieval system