KEGG   Homo sapiens (human): 7020Help
Entry
7020              CDS       T01001                                 

Gene name
TFAP2A, AP-2, AP-2alpha, AP2TF, BOFS, TFAP2
Definition
(RefSeq) transcription factor AP-2 alpha
  KO
K09176  
transcription factor AP-2 alpha/beta
Organism
hsa  Homo sapiens (human)
Disease
H00817  
Branchiooculofacial syndrome (BOFS)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other basic domains
   AP-2 (bHSH)
    7020 (TFAP2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p24
AA seq 437 aa AA seqDB search
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPP
PYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSG
LDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPV
SLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP
PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL
ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLG
NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS
HTDNNAKSSDKEEKHRK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctttggaaattgacggataatatcaagtacgaggactgcgaggaccgtcacgacggc
accagcaacgggacggcacggttgccccagctgggcactgtaggtcaatctccctacacg
agcgccccgccgctgtcccacacccccaatgccgacttccagcccccatacttcccccca
ccctaccagcctatctacccccagtcgcaagatccttactcccacgtcaacgacccctac
agcctgaaccccctgcacgcccagccgcagccgcagcacccaggctggcccggccagagg
cagagccaggagtctgggctcctgcacacgcaccgggggctgcctcaccagctgtcgggc
ctggatcctcgcagggactacaggcggcacgaggacctcctgcacggcccacacgcgctc
agctcaggactcggagacctctcgatccactccttacctcacgccatcgaggaggtcccg
catgtagaagacccgggtattaacatcccagatcaaactgtaattaagaaaggccccgtg
tccctgtccaagtccaacagcaatgccgtctccgccatccctattaacaaggacaacctc
ttcggcggcgtggtgaaccccaacgaagtcttctgttcagttccgggtcgcctctcgctc
ctcagctccacctcgaagtacaaggtcacggtggcggaagtgcagcggcggctctcacca
cccgagtgtctcaacgcgtcgctgctgggcggagtgctccggagggcgaagtctaaaaat
ggaggaagatctttaagagaaaaactggacaaaataggattaaatctgcctgcagggaga
cgtaaagctgccaacgttaccctgctcacatcactagtagagggagaagctgtccaccta
gccagggactttgggtacgtgtgcgaaaccgaatttcctgccaaagcagtagctgaattt
ctcaaccgacaacattccgatcccaatgagcaagtgacaagaaaaaacatgctcctggct
acaaaacagatatgcaaagagttcaccgacctgctggctcaggaccgatctcccctgggg
aactcacggcccaaccccatcctggagcccggcatccagagctgcttgacccacttcaac
ctcatctcccacggcttcggcagccccgcggtgtgtgccgcggtcacggccctgcagaac
tatctcaccgaggccctcaaggccatggacaaaatgtacctcagcaacaaccccaacagc
cacacggacaacaacgccaaaagcagtgacaaagaggagaagcacagaaagtga

DBGET integrated database retrieval system