KEGG   Homo sapiens (human): 7020Help
Entry
7020              CDS       T01001                                 

Gene name
TFAP2A, AP-2, AP-2alpha, AP2TF, BOFS, TFAP2
Definition
transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Orthology
K09176  
transcription factor AP-2 alpha/beta
Organism
hsa  Homo sapiens (human)
Disease
H00817  
Branchiooculofacial syndrome (BOFS)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p24
AA seq 431 aa AA seqDB search
MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIY
PQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRD
YRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSN
SNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNA
SLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGY
VCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNP
ILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNA
KSSDKEEKHRK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttagttcacagtttttcagccatggaccgtcacgacggcaccagcaacgggacggca
cggttgccccagctgggcactgtaggtcaatctccctacacgagcgccccgccgctgtcc
cacacccccaatgccgacttccagcccccatacttccccccaccctaccagcctatctac
ccccagtcgcaagatccttactcccacgtcaacgacccctacagcctgaaccccctgcac
gcccagccgcagccgcagcacccaggctggcccggccagaggcagagccaggagtctggg
ctcctgcacacgcaccgggggctgcctcaccagctgtcgggcctggatcctcgcagggac
tacaggcggcacgaggacctcctgcacggcccacacgcgctcagctcaggactcggagac
ctctcgatccactccttacctcacgccatcgaggaggtcccgcatgtagaagacccgggt
attaacatcccagatcaaactgtaattaagaaaggccccgtgtccctgtccaagtccaac
agcaatgccgtctccgccatccctattaacaaggacaacctcttcggcggcgtggtgaac
cccaacgaagtcttctgttcagttccgggtcgcctctcgctcctcagctccacctcgaag
tacaaggtcacggtggcggaagtgcagcggcggctctcaccacccgagtgtctcaacgcg
tcgctgctgggcggagtgctccggagggcgaagtctaaaaatggaggaagatctttaaga
gaaaaactggacaaaataggattaaatctgcctgcagggagacgtaaagctgccaacgtt
accctgctcacatcactagtagagggagaagctgtccacctagccagggactttgggtac
gtgtgcgaaaccgaatttcctgccaaagcagtagctgaatttctcaaccgacaacattcc
gatcccaatgagcaagtgacaagaaaaaacatgctcctggctacaaaacagatatgcaaa
gagttcaccgacctgctggctcaggaccgatctcccctggggaactcacggcccaacccc
atcctggagcccggcatccagagctgcttgacccacttcaacctcatctcccacggcttc
ggcagccccgcggtgtgtgccgcggtcacggccctgcagaactatctcaccgaggccctc
aaggccatggacaaaatgtacctcagcaacaaccccaacagccacacggacaacaacgcc
aaaagcagtgacaaagaggagaagcacagaaagtga

DBGET integrated database retrieval system