KEGG   Homo sapiens (human): 7054Help
Entry
7054              CDS       T01001                                 

Gene name
TH, DYT14, DYT5b, TYH
Definition
tyrosine hydroxylase (EC:1.14.16.2)
Orthology
K00501  
tyrosine 3-monooxygenase [EC:1.14.16.2]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Prolactin signaling pathway
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H00831  
Primary dystonia
Drug target
Metirosine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7054 (TH)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    7054 (TH)
  Nervous system
   04728 Dopaminergic synapse
    7054 (TH)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7054 (TH)
  Substance dependence
   05030 Cocaine addiction
    7054 (TH)
   05031 Amphetamine addiction
    7054 (TH)
   05034 Alcoholism
    7054 (TH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.2  tyrosine 3-monooxygenase
     7054 (TH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 497 aa AA seqDB search
MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIEDARKEREAAVAAAAAAV
PSEPGDPLEAVAFEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQR
PRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHLV
TKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLK
GLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFL
ASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASD
EEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQ
PYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLE
GVQDELDTLAHALSAIG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccccgacgccaccacgccacaggccaagggcttccgcagggccgtgtctgag
ctggacgccaagcaggcagaggccatcatgtccccgcggttcattgggcgcaggcagagc
ctcatcgaggacgcccgcaaggagcgggaggcggcggtggcagcagcggccgctgcagtc
ccctcggagcccggggaccccctggaggctgtggcctttgaggagaaggaggggaaggcc
gtgctaaacctgctcttctccccgagggccaccaagccctcggcgctgtcccgagctgtg
aaggtgtttgagacgtttgaagccaaaatccaccatctagagacccggcccgcccagagg
ccgcgagctgggggcccccacctggagtacttcgtgcgcctcgaggtgcgccgaggggac
ctggccgccctgctcagtggtgtgcgccaggtgtcagaggacgtgcgcagccccgcgggg
cccaaggtcccctggttcccaagaaaagtgtcagagctggacaagtgtcatcacctggtc
accaagttcgaccctgacctggacttggaccacccgggcttctcggaccaggtgtaccgc
cagcgcaggaagctgattgctgagatcgccttccagtacaggcacggcgacccgattccc
cgtgtggagtacaccgccgaggagattgccacctggaaggaggtctacaccacgctgaag
ggcctctacgccacgcacgcctgcggggagcacctggaggcctttgctttgctggagcgc
ttcagcggctaccgggaagacaatatcccccagctggaggacgtctcccgcttcctgaag
gagcgcacgggcttccagctgcggcctgtggccggcctgctgtccgcccgggacttcctg
gccagcctggccttccgcgtgttccagtgcacccagtatatccgccacgcgtcctcgccc
atgcactcccctgagccggactgctgccacgagctgctggggcacgtgcccatgctggcc
gaccgcaccttcgcgcagttctcgcaggacattggcctggcgtccctgggggcctcggat
gaggaaattgagaagctgtccacgctgtactggttcacggtggagttcgggctgtgtaag
cagaacggggaggtgaaggcctatggtgccgggctgctgtcctcctacggggagctcctg
cactgcctgtctgaggagcctgagattcgggccttcgaccctgaggctgcggccgtgcag
ccctaccaagaccagacgtaccagtcagtctacttcgtgtctgagagcttcagtgacgcc
aaggacaagctcaggagctatgcctcacgcatccagcgccccttctccgtgaagttcgac
ccgtacacgctggccatcgacgtgctggacagcccccaggccgtgcggcgctccctggag
ggtgtccaggatgagctggacacccttgcccatgcgctgagtgccattggctag

DBGET integrated database retrieval system