KEGG   Homo sapiens (human): 7054Help
Entry
7054              CDS       T01001                                 

Gene name
TH, DYT14, DYT5b, TYH
Definition
tyrosine hydroxylase (EC:1.14.16.2)
Orthology
K00501  
tyrosine 3-monooxygenase [EC:1.14.16.2]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Prolactin signaling pathway
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H00831  
Primary dystonia
Drug target
Metirosine: 
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 497 aa AA seqDB search
MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIEDARKEREAAVAAAAAAV
PSEPGDPLEAVAFEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQR
PRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHLV
TKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLK
GLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFL
ASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASD
EEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQ
PYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLE
GVQDELDTLAHALSAIG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccccgacgccaccacgccacaggccaagggcttccgcagggccgtgtctgag
ctggacgccaagcaggcagaggccatcatgtccccgcggttcattgggcgcaggcagagc
ctcatcgaggacgcccgcaaggagcgggaggcggcggtggcagcagcggccgctgcagtc
ccctcggagcccggggaccccctggaggctgtggcctttgaggagaaggaggggaaggcc
gtgctaaacctgctcttctccccgagggccaccaagccctcggcgctgtcccgagctgtg
aaggtgtttgagacgtttgaagccaaaatccaccatctagagacccggcccgcccagagg
ccgcgagctgggggcccccacctggagtacttcgtgcgcctcgaggtgcgccgaggggac
ctggccgccctgctcagtggtgtgcgccaggtgtcagaggacgtgcgcagccccgcgggg
cccaaggtcccctggttcccaagaaaagtgtcagagctggacaagtgtcatcacctggtc
accaagttcgaccctgacctggacttggaccacccgggcttctcggaccaggtgtaccgc
cagcgcaggaagctgattgctgagatcgccttccagtacaggcacggcgacccgattccc
cgtgtggagtacaccgccgaggagattgccacctggaaggaggtctacaccacgctgaag
ggcctctacgccacgcacgcctgcggggagcacctggaggcctttgctttgctggagcgc
ttcagcggctaccgggaagacaatatcccccagctggaggacgtctcccgcttcctgaag
gagcgcacgggcttccagctgcggcctgtggccggcctgctgtccgcccgggacttcctg
gccagcctggccttccgcgtgttccagtgcacccagtatatccgccacgcgtcctcgccc
atgcactcccctgagccggactgctgccacgagctgctggggcacgtgcccatgctggcc
gaccgcaccttcgcgcagttctcgcaggacattggcctggcgtccctgggggcctcggat
gaggaaattgagaagctgtccacgctgtactggttcacggtggagttcgggctgtgtaag
cagaacggggaggtgaaggcctatggtgccgggctgctgtcctcctacggggagctcctg
cactgcctgtctgaggagcctgagattcgggccttcgaccctgaggctgcggccgtgcag
ccctaccaagaccagacgtaccagtcagtctacttcgtgtctgagagcttcagtgacgcc
aaggacaagctcaggagctatgcctcacgcatccagcgccccttctccgtgaagttcgac
ccgtacacgctggccatcgacgtgctggacagcccccaggccgtgcggcgctccctggag
ggtgtccaggatgagctggacacccttgcccatgcgctgagtgccattggctag

DBGET integrated database retrieval system