KEGG   Homo sapiens (human): 7070Help
Entry
7070              CDS       T01001                                 

Gene name
THY1, CD90
Definition
Thy-1 cell surface antigen
Orthology
K06514  
Thy-1 cell surface antigen
Organism
hsa  Homo sapiens (human)
Pathway
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7070 (THY1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7070 (THY1)
Cellular antigens [BR:hsa04090]
 Proteins
  7070 (THY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q23.3
AA seq 161 aa AA seqDB search
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggccatcagcatcgctctcctgctaacagtcttgcaggtctcccgagggcag
aaggtgaccagcctaacggcctgcctagtggaccagagccttcgtctggactgccgccat
gagaataccagcagttcacccatccagtacgagttcagcctgacccgtgagacaaagaag
cacgtgctctttggcactgtgggggtgcctgagcacacataccgctcccgaaccaacttc
accagcaaatacaacatgaaggtcctctacttatccgccttcactagcaaggacgagggc
acctacacgtgtgcactccaccactctggccattccccacccatctcctcccagaacgtc
acagtgctcagagacaaactggtcaagtgtgagggcatcagcctgctggctcagaacacc
tcgtggctgctgctgctcctgctctccctctccctcctccaggccacggatttcatgtcc
ctgtga

DBGET integrated database retrieval system