KEGG   Homo sapiens (human): 7099Help
Entry
7099              CDS       T01001                                 

Gene name
TLR4, ARMD10, CD284, TLR-4, TOLL
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05205  Proteoglycans in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Module
hsa_M00686  Toll-like receptor signaling
Disease
H00821  Age-related macular degeneration
Drug target
Eritoran (DG01426): D04043 D09573
Mifamurtide: D06619
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7099 (TLR4)
   04066 HIF-1 signaling pathway
    7099 (TLR4)
   04151 PI3K-Akt signaling pathway
    7099 (TLR4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7099 (TLR4)
  Cell growth and death
   04217 Necroptosis
    7099 (TLR4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7099 (TLR4)
   04621 NOD-like receptor signaling pathway
    7099 (TLR4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7099 (TLR4)
  Immune diseases
   05323 Rheumatoid arthritis
    7099 (TLR4)
   05321 Inflammatiory bowel disease (IBD)
    7099 (TLR4)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7099 (TLR4)
   05132 Salmonella infection
    7099 (TLR4)
   05133 Pertussis
    7099 (TLR4)
   05134 Legionellosis
    7099 (TLR4)
   05152 Tuberculosis
    7099 (TLR4)
   05162 Measles
    7099 (TLR4)
   05164 Influenza A
    7099 (TLR4)
   05161 Hepatitis B
    7099 (TLR4)
   05146 Amoebiasis
    7099 (TLR4)
   05144 Malaria
    7099 (TLR4)
   05145 Toxoplasmosis
    7099 (TLR4)
   05140 Leishmaniasis
    7099 (TLR4)
   05142 Chagas disease (American trypanosomiasis)
    7099 (TLR4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    7099 (TLR4)
CD molecules [BR:hsa04090]
 Proteins
  7099 (TLR4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   7099 (TLR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 LRR_9 TIR_2 LRR_1 LRR_6 DUF1863
Motif
Other DBs
NCBI-GeneID: 7099
NCBI-ProteinID: NP_612564
OMIM: 603030
HGNC: 11850
Ensembl: ENSG00000136869
Vega: OTTHUMG00000021046
Pharos: O00206(Tchem)
UniProt: O00206
Structure
PDB: 

Jmol
Position
9q33.1
AA seq 839 aa AA seqDB search
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgcctcgcgcctggctgggactctgatcccagccatggccttcctctcctgc
gtgagaccagaaagctgggagccctgcgtggaggtggttcctaatattacttatcaatgc
atggagctgaatttctacaaaatccccgacaacctccccttctcaaccaagaacctggac
ctgagctttaatcccctgaggcatttaggcagctatagcttcttcagtttcccagaactg
caggtgctggatttatccaggtgtgaaatccagacaattgaagatggggcatatcagagc
ctaagccacctctctaccttaatattgacaggaaaccccatccagagtttagccctggga
gccttttctggactatcaagtttacagaagctggtggctgtggagacaaatctagcatct
ctagagaacttccccattggacatctcaaaactttgaaagaacttaatgtggctcacaat
cttatccaatctttcaaattacctgagtatttttctaatctgaccaatctagagcacttg
gacctttccagcaacaagattcaaagtatttattgcacagacttgcgggttctacatcaa
atgcccctactcaatctctctttagacctgtccctgaaccctatgaactttatccaacca
ggtgcatttaaagaaattaggcttcataagctgactttaagaaataattttgatagttta
aatgtaatgaaaacttgtattcaaggtctggctggtttagaagtccatcgtttggttctg
ggagaatttagaaatgaaggaaacttggaaaagtttgacaaatctgctctagagggcctg
tgcaatttgaccattgaagaattccgattagcatacttagactactacctcgatgatatt
attgacttatttaattgtttgacaaatgtttcttcattttccctggtgagtgtgactatt
gaaagggtaaaagacttttcttataatttcggatggcaacatttagaattagttaactgt
aaatttggacagtttcccacattgaaactcaaatctctcaaaaggcttactttcacttcc
aacaaaggtgggaatgctttttcagaagttgatctaccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaaagtgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatggtgttattaccatgagttcaaacttcttgggc
ttagaacaactagaacatctggatttccagcattccaatttgaaacaaatgagtgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatcttcaatggcttgtccagtctcgaagtcttgaaaatggctggc
aattctttccaggaaaacttccttccagatatcttcacagagctgagaaacttgaccttc
ctggacctctctcagtgtcaactggagcagttgtctccaacagcatttaactcactctcc
agtcttcaggtactaaatatgagccacaacaacttcttttcattggatacgtttccttat
aagtgtctgaactccctccaggttcttgattacagtctcaatcacataatgacttccaaa
aaacaggaactacagcattttccaagtagtctagctttcttaaatcttactcagaatgac
tttgcttgtacttgtgaacaccagagtttcctgcaatggatcaaggaccagaggcagctc
ttggtggaagttgaacgaatggaatgtgcaacaccttcagataagcagggcatgcctgtg
ctgagtttgaatatcacctgtcagatgaataagaccatcattggtgtgtcggtcctcagt
gtgcttgtagtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacatctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgagctagtaaagaatttagaagaaggggtg
cctccatttcagctctgccttcactacagagactttattcccggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtgtcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagaccctgctcagg
cagcaggtggagctgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggcggcacatcttctggagacgactcagaaaagccctgctggatggtaaatca
tggaatccagaaggaacagtgggtacaggatgcaattggcaggaagcaacatctatctga

DBGET integrated database retrieval system