KEGG   Homo sapiens (human): 71Help
Entry
71                CDS       T01001                                 

Gene name
ACTG1, ACT, ACTG, BRWS2, DFNA20, DFNA26, HEL-176
Definition
actin, gamma 1
Orthology
K05692  
actin beta/gamma 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
Hippo signaling pathway
Focal adhesion
Adherens junction
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Bacterial invasion of epithelial cells
Vibrio cholerae infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Influenza A
Proteoglycans in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    71 (ACTG1)
   04390 Hippo signaling pathway
    71 (ACTG1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    71 (ACTG1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    71 (ACTG1)
  Cell communication
   04510 Focal adhesion
    71 (ACTG1)
   04520 Adherens junction
    71 (ACTG1)
   04530 Tight junction
    71 (ACTG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    71 (ACTG1)
   04670 Leukocyte transendothelial migration
    71 (ACTG1)
  Endocrine system
   04921 Oxytocin signaling pathway
    71 (ACTG1)
   04919 Thyroid hormone signaling pathway
    71 (ACTG1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    71 (ACTG1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    71 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    71 (ACTG1)
   05414 Dilated cardiomyopathy (DCM)
    71 (ACTG1)
   05416 Viral myocarditis
    71 (ACTG1)
  Infectious diseases
   05110 Vibrio cholerae infection
    71 (ACTG1)
   05130 Pathogenic Escherichia coli infection
    71 (ACTG1)
   05132 Salmonella infection
    71 (ACTG1)
   05131 Shigellosis
    71 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    71 (ACTG1)
   05164 Influenza A
    71 (ACTG1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     71 (ACTG1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    71 (ACTG1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   71 (ACTG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagagatcgccgcgctggtcattgacaatggctccggcatgtgcaaagctggt
tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgccccagacac
cagggcgtcatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcgtggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggccccggaggag
cacccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact
cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg
tccctctacgcctctgggcgcaccactggcattgtcatggactctggagacggggtcacc
cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcactgagcgaggctacagcttc
accaccacggccgagcgggaaatcgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccaccgccgcatcctcctcttctctggagaagagctac
gagctgcccgatggccaggtcatcaccattggcaatgagcggttccggtgtccggaggcg
ctgttccagccttccttcctgggtatggaatcttgcggcatccacgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtacgccaacacggtgctgtcg
ggcggcaccaccatgtacccgggcattgccgacaggatgcagaaggagatcaccgccctg
gcgcccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcggtgtgg
atcggtggctccatcctggcctcactgtccaccttccagcagatgtggattagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system