KEGG   Homo sapiens (human): 710Help
Entry
710               CDS       T01001                                 

Gene name
SERPING1, C1IN, C1INH, C1NH, HAE1, HAE2
Definition
serpin peptidase inhibitor, clade G (C1 inhibitor), member 1
Orthology
K04001  
C1 inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Pertussis
Disease
H00106  
Complement regulatory protein defects
H01006  
Hereditary angioedema
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.1
AA seq 500 aa AA seqDB search
MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPIL
EVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTG
SFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQ
VLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNAS
RTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWK
TTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVP
QNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFD
FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFV
LWDQQHKFPVFMGRVYDPRA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaggctgaccctgctgaccctcctgctgctgctgctggctggggatagagcc
tcctcaaatccaaatgctaccagctccagctcccaggatccagagagtttgcaagacaga
ggcgaagggaaggtcgcaacaacagttatctccaagatgctattcgttgaacccatcctg
gaggtttccagcttgccgacaaccaactcaacaaccaattcagccaccaaaataacagct
aataccactgatgaacccaccacacaacccaccacagagcccaccacccaacccaccatc
caacccacccaaccaactacccagctcccaacagattctcctacccagcccactactggg
tccttctgcccaggacctgttactctctgctctgacttggagagtcattcaacagaggcc
gtgttgggggatgctttggtagatttctccctgaagctctaccacgccttctcagcaatg
aagaaggtggagaccaacatggccttttccccattcagcatcgccagcctccttacccag
gtcctgctcggggctggggagaacaccaaaacaaacctggagagcatcctctcttacccc
aaggacttcacctgtgtccaccaggccctgaagggcttcacgaccaaaggtgtcacctca
gtctctcagatcttccacagcccagacctggccataagggacacctttgtgaatgcctct
cggaccctgtacagcagcagccccagagtcctaagcaacaacagtgacgccaacttggag
ctcatcaacacctgggtggccaagaacaccaacaacaagatcagccggctgctagacagt
ctgccctccgatacccgccttgtcctcctcaatgctatctacctgagtgccaagtggaag
acaacatttgatcccaagaaaaccagaatggaaccctttcacttcaaaaactcagttata
aaagtgcccatgatgaatagcaagaagtaccctgtggcccatttcattgaccaaactttg
aaagccaaggtggggcagctgcagctctcccacaatctgagtttggtgatcctggtaccc
cagaacctgaaacatcgtcttgaagacatggaacaggctctcagcccttctgttttcaag
gccatcatggagaaactggagatgtccaagttccagcccactctcctaacactaccccgc
atcaaagtgacgaccagccaggatatgctctcaatcatggagaaattggaattcttcgat
ttttcttatgaccttaacctgtgtgggctgacagaggacccagatcttcaggtttctgcg
atgcagcaccagacagtgctggaactgacagagactggggtggaggcggctgcagcctcc
gccatctctgtggcccgcaccctgctggtctttgaagtgcagcagcccttcctcttcgtg
ctctgggaccagcagcacaagttccctgtcttcatggggcgagtatatgaccccagggcc
tga

DBGET integrated database retrieval system