KEGG   Homo sapiens (human): 713Help
Entry
713               CDS       T01001                                 

Gene name
C1QB
Definition
(RefSeq) complement C1q B chain
  KO
K03987  
complement C1q subcomponent subunit B
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Prion diseases
Pertussis
Chagas disease (American trypanosomiasis)
Staphylococcus aureus infection
Systemic lupus erythematosus
Disease
H00102  
Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    713 (C1QB)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    713 (C1QB)
  Neurodegenerative diseases
   05020 Prion diseases
    713 (C1QB)
  Infectious diseases
   05133 Pertussis
    713 (C1QB)
   05150 Staphylococcus aureus infection
    713 (C1QB)
   05142 Chagas disease (American trypanosomiasis)
    713 (C1QB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.12
AA seq 253 aa AA seqDB search
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaagatcccatggggcagcatcccagtactgatgttgctcctgctcctgggc
ctaatcgatatctcccaggcccagctcagctgcaccgggcccccagccatccctggcatc
ccgggtatccctgggacacctggccccgatggccaacctgggaccccagggataaaagga
gagaaagggcttccagggctggctggagaccatggtgagttcggagagaagggagaccca
gggattcctgggaatccaggaaaagtcggccccaagggccccatgggccctaaaggtggc
ccaggggcccctggagccccaggccccaaaggtgaatcgggagactacaaggccacccag
aaaatcgccttctctgccacaagaaccatcaacgtccccctgcgccgggaccagaccatc
cgcttcgaccacgtgatcaccaacatgaacaacaattatgagccccgcagtggcaagttc
acctgcaaggtgcccggtctctactacttcacctaccacgccagctctcgagggaacctg
tgcgtgaacctcatgcgtggccgggagcgtgcacagaaggtggtcaccttctgtgactat
gcctacaacaccttccaggtcaccaccggtggcatggtcctcaagctggagcagggggag
aacgtcttcctgcaggccaccgacaagaactcactactgggcatggagggtgccaacagc
atcttttccgggttcctgctctttccagatatggaggcctga

DBGET integrated database retrieval system