KEGG   Homo sapiens (human): 7133Help
Entry
7133              CDS       T01001                                 

Gene name
TNFRSF1B, CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
Definition
tumor necrosis factor receptor superfamily, member 1B
Orthology
K05141  
tumor necrosis factor receptor superfamily member 1B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TNF signaling pathway
Adipocytokine signaling pathway
Amyotrophic lateral sclerosis (ALS)
Disease
H00084  
Graft-versus-host disease
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 461 aa AA seqDB search
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgtcgccgtctgggccgcgctggccgtcggactggagctctgggctgcggcg
cacgccttgcccgcccaggtggcatttacaccctacgccccggagcccgggagcacatgc
cggctcagagaatactatgaccagacagctcagatgtgctgcagcaaatgctcgccgggc
caacatgcaaaagtcttctgtaccaagacctcggacaccgtgtgtgactcctgtgaggac
agcacatacacccagctctggaactgggttcccgagtgcttgagctgtggctcccgctgt
agctctgaccaggtggaaactcaagcctgcactcgggaacagaaccgcatctgcacctgc
aggcccggctggtactgcgcgctgagcaagcaggaggggtgccggctgtgcgcgccgctg
cgcaagtgccgcccgggcttcggcgtggccagaccaggaactgaaacatcagacgtggtg
tgcaagccctgtgccccggggacgttctccaacacgacttcatccacggatatttgcagg
ccccaccagatctgtaacgtggtggccatccctgggaatgcaagcatggatgcagtctgc
acgtccacgtcccccacccggagtatggccccaggggcagtacacttaccccagccagtg
tccacacgatcccaacacacgcagccaactccagaacccagcactgctccaagcacctcc
ttcctgctcccaatgggccccagccccccagctgaagggagcactggcgacttcgctctt
ccagttggactgattgtgggtgtgacagccttgggtctactaataataggagtggtgaac
tgtgtcatcatgacccaggtgaaaaagaagcccttgtgcctgcagagagaagccaaggtg
cctcacttgcctgccgataaggcccggggtacacagggccccgagcagcagcacctgctg
atcacagcgccgagctccagcagcagctccctggagagctcggccagtgcgttggacaga
agggcgcccactcggaaccagccacaggcaccaggcgtggaggccagtggggccggggag
gcccgggccagcaccgggagctcagattcttcccctggtggccatgggacccaggtcaat
gtcacctgcatcgtgaacgtctgtagcagctctgaccacagctcacagtgctcctcccaa
gccagctccacaatgggagacacagattccagcccctcggagtccccgaaggacgagcag
gtccccttctccaaggaggaatgtgcctttcggtcacagctggagacgccagagaccctg
ctggggagcaccgaagagaagcccctgccccttggagtgcctgatgctgggatgaagccc
agttaa

DBGET integrated database retrieval system