KEGG   Homo sapiens (human): 7133Help
Entry
7133              CDS       T01001                                 

Gene name
TNFRSF1B, CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
Definition
tumor necrosis factor receptor superfamily, member 1B
Orthology
K05141  
tumor necrosis factor receptor superfamily member 1B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TNF signaling pathway
Adipocytokine signaling pathway
Amyotrophic lateral sclerosis (ALS)
Disease
H00084  
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    7133 (TNFRSF1B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7133 (TNFRSF1B)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    7133 (TNFRSF1B)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    7133 (TNFRSF1B)
Cellular antigens [BR:hsa04090]
 Proteins
  7133 (TNFRSF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 461 aa AA seqDB search
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgtcgccgtctgggccgcgctggccgtcggactggagctctgggctgcggcg
cacgccttgcccgcccaggtggcatttacaccctacgccccggagcccgggagcacatgc
cggctcagagaatactatgaccagacagctcagatgtgctgcagcaaatgctcgccgggc
caacatgcaaaagtcttctgtaccaagacctcggacaccgtgtgtgactcctgtgaggac
agcacatacacccagctctggaactgggttcccgagtgcttgagctgtggctcccgctgt
agctctgaccaggtggaaactcaagcctgcactcgggaacagaaccgcatctgcacctgc
aggcccggctggtactgcgcgctgagcaagcaggaggggtgccggctgtgcgcgccgctg
cgcaagtgccgcccgggcttcggcgtggccagaccaggaactgaaacatcagacgtggtg
tgcaagccctgtgccccggggacgttctccaacacgacttcatccacggatatttgcagg
ccccaccagatctgtaacgtggtggccatccctgggaatgcaagcatggatgcagtctgc
acgtccacgtcccccacccggagtatggccccaggggcagtacacttaccccagccagtg
tccacacgatcccaacacacgcagccaactccagaacccagcactgctccaagcacctcc
ttcctgctcccaatgggccccagccccccagctgaagggagcactggcgacttcgctctt
ccagttggactgattgtgggtgtgacagccttgggtctactaataataggagtggtgaac
tgtgtcatcatgacccaggtgaaaaagaagcccttgtgcctgcagagagaagccaaggtg
cctcacttgcctgccgataaggcccggggtacacagggccccgagcagcagcacctgctg
atcacagcgccgagctccagcagcagctccctggagagctcggccagtgcgttggacaga
agggcgcccactcggaaccagccacaggcaccaggcgtggaggccagtggggccggggag
gcccgggccagcaccgggagctcagattcttcccctggtggccatgggacccaggtcaat
gtcacctgcatcgtgaacgtctgtagcagctctgaccacagctcacagtgctcctcccaa
gccagctccacaatgggagacacagattccagcccctcggagtccccgaaggacgagcag
gtccccttctccaaggaggaatgtgcctttcggtcacagctggagacgccagagaccctg
ctggggagcaccgaagagaagcccctgccccttggagtgcctgatgctgggatgaagccc
agttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system