KEGG   Homo sapiens (human): 7139Help
Entry
7139              CDS       T01001                                 

Gene name
TNNT2, CMH2, CMPD2, LVNC6, RCM3, TnTC, cTnT, CMD1D
Definition
troponin T type 2 (cardiac)
Orthology
K12045  
troponin T, cardiac muscle
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
H01216  
Left ventricular noncompaction (LVNC)
H01219  
Restrictive cardiomyopathy (RCM)
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 295 aa AA seqDB search
MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEE
EAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHF
ENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAED
EARKKKALSNMMHFGGYIQKTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA
KELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacatagaagaggtggtggaagagtacgaggaggaggagcaggaagaagcagct
gttgaagaagaggaggactggagagaggacgaagacgagcaggaggaggcagcggaagag
gatgctgaagcagaggctgagaccgaggagaccagggcagaagaagatgaagaagaagag
gaagcaaaggaggctgaagatggcccaatggaggagtccaaaccaaagcccaggtcgttc
atgcccaacttggtgcctcccaagatccccgatggagagagagtggactttgatgacatc
caccggaagcgcatggagaaggacctgaatgagttgcaggcgctgatcgaggctcacttt
gagaacaggaagaaagaggaggaggagctcgtttctctcaaagacaggatcgagagacgt
cgggcagagcgggccgagcagcagcgcatccggaatgagcgggagaaggagcggcagaac
cgcctggctgaagagagggctcgacgagaggaggaggagaacaggaggaaggctgaggat
gaggcccggaagaagaaggctttgtccaacatgatgcattttgggggttacatccagaag
acagagcggaaaagtgggaagaggcagactgagcgggaaaagaagaagaagattctggct
gagaggaggaaggtgctggccattgaccacctgaatgaagatcagctgagggagaaggcc
aaggagctgtggcagagcatctataacttggaggcagagaagttcgacctgcaggagaag
ttcaagcagcagaaatatgagatcaatgttctccgaaacaggatcaacgataaccagaaa
gtctccaagacccgcgggaaggctaaagtcaccgggcgctggaaatag

DBGET integrated database retrieval system