KEGG   Homo sapiens (human): 7187Help
Entry
7187              CDS       T01001                                 

Gene name
TRAF3, CAP-1, CAP1, CD40bp, CRAF1, IIAE5, LAP1
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  
TNF receptor-associated factor 3
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
TNF signaling pathway
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7187 (TRAF3)
   04668 TNF signaling pathway
    7187 (TRAF3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7187 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    7187 (TRAF3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7187 (TRAF3)
   05203 Viral carcinogenesis
    7187 (TRAF3)
   05222 Small cell lung cancer
    7187 (TRAF3)
  Infectious diseases
   05160 Hepatitis C
    7187 (TRAF3)
   05168 Herpes simplex infection
    7187 (TRAF3)
   05169 Epstein-Barr virus infection
    7187 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.32
AA seq 568 aa AA seqDB search
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactctcctggcgcgctgcagactaacccgccgctaaag
ctgcacactgaccgcagtgctgggacgccagtttttgtccctgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgccacctggtgctg
tgcagcccgaagcagaccgagtgtgggcaccgcttctgcgagagctgcatggcggccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaatgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtgcgtcctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacatgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacacgaagacaccgactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagcttgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctagcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggagtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacactggttactttggctataagatgtgtgccagggtctacctg
aacggggacgggatggggaaggggacgcacttgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccttggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcgacgtcatttgggagatgcattcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system