KEGG   Homo sapiens (human): 7201Help
Entry
7201              CDS       T01001                                 

Gene name
TRHR, TRH-R
Definition
thyrotropin-releasing hormone receptor
Orthology
K04282  
thyrotropin-releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Thyrotropin alfa: 
Protirelin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7201 (TRHR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7201 (TRHR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Thyrotropin-releasing hormone
    7201 (TRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q23
AA seq 398 aa AA seqDB search
MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES
DHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgagacagtcagtgaactgaaccaaacacagcttcagccacgagcagtggtg
gccttagaataccaggtggtcaccatcttacttgtactcattatttgtggcctgggcatt
gtaggcaacatcatggtagtcctggttgtcatgagaaccaagcacatgaggacccccaca
aactgctacctggtgagcctggcagtagctgatctcatggtcttggtggccgcaggcctc
cccaacataacagacagtatctacggttcctgggtctatggctatgttggatgcctctgc
attacttacctccagtatttgggaattaatgcatcctcttgttcaataacagcctttacc
attgagaggtacatagcaatctgtcaccccatcaaagcccagtttctctgcacattttcc
agagccaaaaagattatcatctttgtctgggctttcacatctctttactgtatgctctgg
ttcttcttgctggatctcaatattagcacctacaaagatgctattgtgatatcctgtggc
tacaagatctccaggaattactactcacctatttacctaatggactttggtgtcttttat
gttgtgccaatgatcctggctaccgtcctctatggattcatagctagaatccttttctta
aatcccattccttcagatcctaaagaaaactctaagacatggaaaaatgattcaacccat
cagaacacaaatctgaatgtaaatacctctaatagatgtttcaacagcacagtatcttca
aggaagcaggtcaccaagatgctggcagtggttgtaattctgtttgcccttttatggatg
ccctacaggactctagtggttgtcaactcatttctctccagtcctttccaagaaaattgg
tttttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccggtgatttac
aatctcatgtcccagaaattccgtgcagccttcagaaagctctgcaactgcaagcagaag
ccaacagagaaacctgctaactacagtgtggccctaaattacagcgtcatcaaggagtca
gaccatttcagcacagagcttgatgatatcactgtcactgacacttacctgtctgccaca
aaagtgtcttttgatgacacctgcttggcttctgaggtatcctttagccaaagttga

DBGET integrated database retrieval system