KEGG   Homo sapiens (human): 7266Help
Entry
7266              CDS       T01001                                 

Gene name
DNAJC7, DJ11, DJC7, TPR2, TTC2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C7
  KO
K09527  
DnaJ homolog subfamily C member 7
Organism
hsa  Homo sapiens (human)
Brite
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   7266 (DNAJC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.2
AA seq 494 aa AA seqDB search
MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFS
FEASGPGNFFFQFG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccgcggagtgcgatgtggtaatggcggcgaccgagccggagctgctcgac
gaccaagaggcgaagagggaagcagagactttcaaggaacaaggaaatgcatactatgcc
aagaaagattacaatgaagcttataattattatacaaaagccatagatatgtgtcctaaa
aatgctagctattatggtaatcgagcagccaccttgatgatgcttggaaggttccgggaa
gctcttggagatgcacaacagtcagtgaggttggatgacagttttgtccggggacatcta
cgagagggcaagtgccacctctctctggggaatgccatggcagcatgtcgcagcttccag
agagccctagaactggatcataaaaatgctcaggcacaacaagagttcaagaatgctaat
gcagtcatggaatatgagaaaatagcagaaacagattttgagaagcgagattttcggaag
gttgttttctgcatggaccgtgccctagaatttgcccctgcctgccatcgcttcaaaatc
ctcaaggcagaatgtttagcaatgctgggtcgttatccagaagcacagtctgtggctagt
gacattctacgaatggattccaccaatgcagatgctctgtatgtacgaggtctttgcctt
tattacgaagattgtattgagaaggcagttcagtttttcgtacaggctctcaggatggct
cctgaccacgagaaggcctgcattgcctgcagaaatgccaaagcactcaaagcaaagaaa
gaagatgggaataaagcatttaaggaaggaaattacaaactagcatatgaactgtacaca
gaagccctggggatagaccccaacaatataaaaacaaatgctaaactctactgtaatcgg
ggtacggttaattccaagcttaggaaactagatgatgcaatagaagactgcacaaatgca
gtgaagcttgatgacacttacataaaagcctacttgagaagagctcagtgttacatggac
acagaacagtatgaagaagcagtacgagactatgaaaaagtataccagacagagaaaaca
aaagaacacaaacagctcctaaaaaatgcgcagctggaactgaagaagagtaagaggaaa
gattactacaagattctaggagtggacaagaatgcctctgaggacgagatcaagaaagct
tatcggaaacgggccttgatgcaccatccagatcggcatagtggagccagtgctgaggtt
cagaaggaggaggagaagaagttcaaggaagttggagaggcctttactatcctctctgat
cccaagaaaaagactcgctatgacagtggacaggacctagatgaggagggcatgaatatg
ggtgattttgatccaaacaatatcttcaaggcattctttggcggtcctggcggcttcagc
tttgaagcatctggtccagggaatttcttttttcaatttggctaa

DBGET integrated database retrieval system