KEGG   Homo sapiens (human): 728294Help
Entry
728294            CDS       T01001                                 

Gene name
D2HGDH, D2HGD
Definition
(RefSeq) D-2-hydroxyglutarate dehydrogenase (EC:1.1.99.-)
Organism
hsa  Homo sapiens (human)
Disease
H01225  
D-2-hydroxyglutaric aciduria (D-2-HGA)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.3
AA seq 521 aa AA seqDB search
MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVRRLPFS
TVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCH
ERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRY
VEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLT
SLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGCPGFAEVLQTFSTCK
GMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLIETSGSNAGHDAEKLGHFLEH
ALGSGLVTDGTMATDQRKVKMLWALRERITEALSRDGYVYKYDLSLPVERLYDIVTDLRA
RLGPHAKHVVGYGHLGDGNLHLNVTAEAFSPSLLAALEPHVYEWTAGQQGSVSAEHGVGF
RKRDVLGYSKPPGALQLMQQLKALLDPKGILNPYKTLPSQA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccgtcggcctctggcgtggcccgcgtggctgttgcggggtgctccgggagcc
gcgggttcttggggtcggccggttggccccctggcccgcagaggctgctgctccgccccg
gggacccccgaggtgccgctgacccgggagcgctaccccgtgcggcgcttgccgttctcc
acggtgtctaagcaggacctggccgcctttgagcgcatcgtgcccggcggggtcgtcacg
gacccggaagcgctgcaggctcccaacgtggactggttgcggacgctgcgaggctgtagc
aaggtgctgctgaggccacggacgtcggaggaggtgtcccacatcctcaggcactgccac
gagaggaacctggccgtgaacccacaggggggcaacacaggcatggtgggtggcagcgtc
cccgtctttgacgagatcatcctctccactgcccgcatgaaccgggtcctcagcttccac
agcgtgtctggaattctggtttgccaggcgggctgcgtcctggaggagctgagccggtat
gtggaggaacgggacttcatcatgccgctggacttaggagccaagggcagctgccacatc
gggggaaacgtggcaaccaacgctggaggcctgcggtttcttcgatatggctcactgcat
gggactgtcctgggcctggaagtggtgctggccgacggcactgtcctggactgcctgacc
tccctgaggaaggacaacacgggctatgacctgaagcagctgttcatcgggtcggagggc
actttggggatcatcaccacggtgtccatcttgtgtccacccaagcccagggctgtgaac
gtggctttcctcggctgcccaggctttgctgaggttctgcagaccttcagcacctgcaag
gggatgctgggtgagatcctgtctgcattcgagttcatggatgctgtgtgcatgcagctg
gtcgggcgccatctccacctggccagcccggtgcaagagagtccgttttacgtcctcatc
gagacttcaggctccaacgcaggccatgacgctgagaagctgggccacttcctggagcac
gcgctgggctccggcctggtgaccgatgggaccatggccaccgaccagaggaaagtcaag
atgctgtgggccctgagggaaaggatcacagaggcgctgagccgggatggctacgtgtac
aagtacgacctctccctccctgtggagcggctctacgacatcgtgactgacctgcgcgcc
cgcctcggcccgcacgccaagcacgtggtgggctatggccaccttggagatggtaacctg
cacctcaatgtgacggcggaggccttcagcccctcgctcctggctgccctggagccccac
gtgtacgagtggacggccgggcagcagggcagcgtcagcgcggagcacggagtgggcttc
aggaagagggacgtcctgggctacagcaagccaccgggggccctgcagctcatgcagcag
ctcaaggccctgctggaccccaagggcatcctcaacccctacaagacgctgcccagccag
gcctga

DBGET integrated database retrieval system