KEGG   Homo sapiens (human): 7306Help
Entry
7306              CDS       T01001                                 

Gene name
TYRP1, CAS2, CATB, GP75, OCA3, TRP, TRP1, TYRP, b-PROTEIN
Definition
(RefSeq) tyrosinase-related protein 1 (EC:1.14.18.-)
  KO
K00506  
tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Melanogenesis
Disease
H00168  
Oculocutaneous albinism (OCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7306 (TYRP1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7306 (TYRP1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     7306 (TYRP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   7306 (TYRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p23
AA seq 537 aa AA seqDB search
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSS
GRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQ
EPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIA
IAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcctaaactcctctctctgggctgtatcttcttccccttgctactttttcag
caggcccgggctcaattcccaagacagtgtgccactgttgaggctttgagaagtggtatg
tgttgcccagacctgtcccctgtgtctgggcctgggacagaccgctgtggctcatcatca
gggaggggcagatgtgaggcagtgactgcagactcccggccccacagccctcagtatccc
catgatggcagagatgatcgggaggtctggcccttgcgcttcttcaataggacatgtcac
tgcaacggcaatttctcaggacacaactgtgggacgtgccgtcctggctggagaggagct
gcctgtgaccagagggttctcatagtcaggagaaatcttctggacttaagtaaagaagaa
aagaaccactttgtccgggccctggatatggcaaagcgcacaactcaccctttatttgtc
attgccaccaggagatcagaagaaatactggggccagatggcaacacgccacaatttgag
aacatttccatttataactactttgtttggacacactattactcagtcaaaaagactttc
cttggggtaggacaggaaagctttggtgaagtggatttctctcatgagggaccagctttt
ctcacatggcacaggtaccacctcctgcgtctggagaaagacatgcaggaaatgttgcaa
gagccttctttctcccttccttactggaattttgcaacggggaaaaatgtctgtgatatc
tgcacggatgacttgatgggatccagaagcaactttgattccactctaataagcccaaac
tctgtcttttctcaatggcgagtggtctgtgactccttggaagattatgataccctggga
acactttgtaacagcaccgaggatgggccaattaggagaaatccagctggaaatgtggcc
agaccaatggtgcaacgtcttcctgaaccacaggatgtcgctcagtgcttggaagttggt
ttatttgacacgcctcctttttattccaactctacaaacagtttccgaaacacagtggaa
ggttacagtgaccccacgggaaagtatgaccctgctgttcgaagtcttcacaatttggct
catctattcctgaatggaacagggggacaaacccatttgtctccaaatgatcctattttt
gtcctcctgcacaccttcacagatgcagtctttgatgaatggctgaggagatacaatgct
gatatatccacatttccattggaaaatgcccctattggacataatagacaatacaacatg
gtgccattctggcccccagtcaccaacacagaaatgtttgttactgctccagacaacctg
ggatacacttatgaaattcaatggccaagtcgggagtttagtgtacctgagataattgcc
atagcagtagttggcgctttgttactggttgcactcatttttgggactgcttcttatctg
attcgtgccagacgcagtatggatgaagctaaccagcctctcctcactgatcagtatcaa
tgctatgctgaagaatatgaaaaactccagaatcctaatcagtctgtggtctaa

DBGET integrated database retrieval system