KEGG   Homo sapiens (human): 7306Help
Entry
7306              CDS       T01001                                 

Gene name
TYRP1, CAS2, CATB, GP75, OCA3, TRP, TRP1, TYRP, b-PROTEIN
Definition
tyrosinase-related protein 1 (EC:1.14.18.-)
Orthology
K00506  
tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Melanogenesis
Disease
H00168  
Oculocutaneous albinism (OCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7306 (TYRP1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7306 (TYRP1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     7306 (TYRP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   7306 (TYRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p23
AA seq 537 aa AA seqDB search
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSS
GRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQ
EPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIA
IAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcctaaactcctctctctgggctgtatcttcttccccttgctactttttcag
caggcccgggctcaattcccaagacagtgtgccactgttgaggctttgagaagtggtatg
tgttgcccagacctgtcccctgtgtctgggcctgggacagaccgctgtggctcatcatca
gggaggggcagatgtgaggcagtgactgcagactcccggccccacagccctcagtatccc
catgatggcagagatgatcgggaggtctggcccttgcgcttcttcaataggacatgtcac
tgcaacggcaatttctcaggacacaactgtgggacgtgccgtcctggctggagaggagct
gcctgtgaccagagggttctcatagtcaggagaaatcttctggacttaagtaaagaagaa
aagaaccactttgtccgggccctggatatggcaaagcgcacaactcaccctttatttgtc
attgccaccaggagatcagaagaaatactggggccagatggcaacacgccacaatttgag
aacatttccatttataactactttgtttggacacactattactcagtcaaaaagactttc
cttggggtaggacaggaaagctttggtgaagtggatttctctcatgagggaccagctttt
ctcacatggcacaggtaccacctcctgcgtctggagaaagacatgcaggaaatgttgcaa
gagccttctttctcccttccttactggaattttgcaacggggaaaaatgtctgtgatatc
tgcacggatgacttgatgggatccagaagcaactttgattccactctaataagcccaaac
tctgtcttttctcaatggcgagtggtctgtgactccttggaagattatgataccctggga
acactttgtaacagcaccgaggatgggccaattaggagaaatccagctggaaatgtggcc
agaccaatggtgcaacgtcttcctgaaccacaggatgtcgctcagtgcttggaagttggt
ttatttgacacgcctcctttttattccaactctacaaacagtttccgaaacacagtggaa
ggttacagtgaccccacgggaaagtatgaccctgctgttcgaagtcttcacaatttggct
catctattcctgaatggaacagggggacaaacccatttgtctccaaatgatcctattttt
gtcctcctgcacaccttcacagatgcagtctttgatgaatggctgaggagatacaatgct
gatatatccacatttccattggaaaatgcccctattggacataatagacaatacaacatg
gtgccattctggcccccagtcaccaacacagaaatgtttgttactgctccagacaacctg
ggatacacttatgaaattcaatggccaagtcgggagtttagtgtacctgagataattgcc
atagcagtagttggcgctttgttactggttgcactcatttttgggactgcttcttatctg
attcgtgccagacgcagtatggatgaagctaaccagcctctcctcactgatcagtatcaa
tgctatgctgaagaatatgaaaaactccagaatcctaatcagtctgtggtctaa

DBGET integrated database retrieval system