KEGG   Homo sapiens (human): 7306Help
Entry
7306              CDS       T01001                                 

Gene name
TYRP1, CAS2, CATB, GP75, OCA3, TRP, TRP1, TYRP, b-PROTEIN
Definition
(RefSeq) tyrosinase related protein 1
  KO
K00506  tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04916  Melanogenesis
Disease
H00168  Oculocutaneous albinism (OCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7306 (TYRP1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7306 (TYRP1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     7306 (TYRP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   7306 (TYRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-GeneID: 7306
NCBI-ProteinID: NP_000541
OMIM: 115501
HGNC: 12450
Ensembl: ENSG00000107165
Vega: OTTHUMG00000021034
Pharos: P17643(Tbio)
UniProt: P17643
Structure
PDB: 

Jmol
Position
9p23
AA seq 537 aa AA seqDB search
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSS
GRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQ
EPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIA
IAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcctaaactcctctctctgggctgtatcttcttccccttgctactttttcag
caggcccgggctcaattcccaagacagtgtgccactgttgaggctttgagaagtggtatg
tgttgcccagacctgtcccctgtgtctgggcctgggacagaccgctgtggctcatcatca
gggaggggcagatgtgaggcagtgactgcagactcccggccccacagccctcagtatccc
catgatggcagagatgatcgggaggtctggcccttgcgcttcttcaataggacatgtcac
tgcaacggcaatttctcaggacacaactgtgggacgtgccgtcctggctggagaggagct
gcctgtgaccagagggttctcatagtcaggagaaatcttctggacttaagtaaagaagaa
aagaaccactttgtccgggccctggatatggcaaagcgcacaactcaccctttatttgtc
attgccaccaggagatcagaagaaatactggggccagatggcaacacgccacaatttgag
aacatttccatttataactactttgtttggacacactattactcagtcaaaaagactttc
cttggggtaggacaggaaagctttggtgaagtggatttctctcatgagggaccagctttt
ctcacatggcacaggtaccacctcctgcgtctggagaaagacatgcaggaaatgttgcaa
gagccttctttctcccttccttactggaattttgcaacggggaaaaatgtctgtgatatc
tgcacggatgacttgatgggatccagaagcaactttgattccactctaataagcccaaac
tctgtcttttctcaatggcgagtggtctgtgactccttggaagattatgataccctggga
acactttgtaacagcaccgaggatgggccaattaggagaaatccagctggaaatgtggcc
agaccaatggtgcaacgtcttcctgaaccacaggatgtcgctcagtgcttggaagttggt
ttatttgacacgcctcctttttattccaactctacaaacagtttccgaaacacagtggaa
ggttacagtgaccccacgggaaagtatgaccctgctgttcgaagtcttcacaatttggct
catctattcctgaatggaacagggggacaaacccatttgtctccaaatgatcctattttt
gtcctcctgcacaccttcacagatgcagtctttgatgaatggctgaggagatacaatgct
gatatatccacatttccattggaaaatgcccctattggacataatagacaatacaacatg
gtgccattctggcccccagtcaccaacacagaaatgtttgttactgctccagacaacctg
ggatacacttatgaaattcaatggccaagtcgggagtttagtgtacctgagataattgcc
atagcagtagttggcgctttgttactggttgcactcatttttgggactgcttcttatctg
attcgtgccagacgcagtatggatgaagctaaccagcctctcctcactgatcagtatcaa
tgctatgctgaagaatatgaaaaactccagaatcctaatcagtctgtggtctaa

DBGET integrated database retrieval system