KEGG   Homo sapiens (human): 7317Help
Entry
7317              CDS       T01001                                 

Gene name
UBA1, A1S9, A1S9T, A1ST, AMCX1, CFAP124, GXP1, POC20, SMAX2, UBA1A, UBE1, UBE1X
Definition
ubiquitin-like modifier activating enzyme 1 (EC:6.3.2.19)
Orthology
K03178  
ubiquitin-activating enzyme E1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Parkinson's disease
Disease
H00455  
Spinal muscular atrophy (SMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7317 (UBA1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7317 (UBA1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     7317 (UBA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7317 (UBA1)
  Exosomal proteins of other body fluids (saliva and urine)
   7317 (UBA1)
  Exosomal proteins of colorectal cancer cells
   7317 (UBA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.23
AA seq 1058 aa AA seqDB search
MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLY
VLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLRE
EDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCH
NRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
GFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKK
ISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVA
LAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI
MQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
CELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMN
PHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGT
LGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPA
ENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSN
NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTG
SQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAA
VVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVS
RVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctcgccgctgtccaagaaacgtcgcgtgtccgggcctgatccaaagccgggt
tctaactgctcccctgcccagtccgtgttgtccgaagtgccctcggtgccaaccaacgga
atggccaagaacggcagtgaagcagacatagacgagggcctttactcccggcagctgtat
gtgttgggccatgaggcaatgaagcggctccagacatccagtgtcctggtatcaggcctg
cggggcctgggcgtggagatcgctaagaacatcatccttggtggggtcaaggctgttacc
ctacatgaccagggcactgcccagtgggctgatctttcctcccagttctacctgcgggag
gaggacatcggtaaaaaccgggccgaggtatcacagccccgcctcgctgagctcaacagc
tatgtgcctgtcactgcctacactggacccctcgttgaggacttccttagtggtttccag
gtggtggtgctcaccaacacccccctggaggaccagctgcgagtgggtgagttctgtcac
aaccgtggcatcaagctggtggtggcagacacgcggggcctgtttgggcagctcttctgt
gactttggagaggaaatgatcctcacagattccaatggggagcagccactcagtgctatg
gtttctatggttaccaaggacaaccccggtgtggttacctgcctggatgaggcccgacac
gggtttgagagcggggactttgtctccttttcagaagtacagggcatggttgaactcaac
ggaaatcagcccatggagatcaaagtcctgggtccttatacctttagcatctgtgacacc
tccaacttctccgactacatccgtggaggcatcgtcagtcaggtcaaagtacctaagaag
attagctttaaatccttggtggcctcactggcagaacctgactttgtggtgacggacttc
gccaagttttctcgccctgcccagctgcacattggcttccaggccctgcaccagttctgt
gctcagcatggccggccacctcggccccgcaatgaggaggatgcagcagaactggtagcc
ttagcacaggctgtgaatgctcgagccctgccagcagtgcagcaaaataacctggacgag
gacctcatccggaagctggcatatgtggctgctggggatctggcacccataaacgccttc
attgggggcctggctgcccaggaagtcatgaaggcctgctccgggaagttcatgcccatc
atgcagtggctatactttgatgcccttgagtgtctccctgaggacaaagaggtcctcaca
gaggacaagtgcctccagcgccagaaccgttatgacgggcaagtggctgtgtttggctca
gacctgcaagagaagctgggcaagcagaagtatttcctggtgggtgcgggggccattggc
tgtgagctgctcaagaactttgccatgattgggctgggctgcggggagggtggagaaatc
atcgttacagacatggacaccattgagaagtcaaatctgaatcgacagtttcttttccgg
ccctgggatgtcacgaagttaaagtctgacacggctgctgcagctgtgcgccaaatgaat
ccacatatccgggtgacaagccaccagaaccgtgtgggtcctgacacggagcgcatctat
gatgacgattttttccaaaacctagatggcgtggccaatgccctggacaacgtggatgcc
cgcatgtacatggaccgccgctgtgtctactaccggaagccactgctggagtcaggcaca
ctgggcaccaaaggcaatgtgcaggtggtgatccccttcctgacagagtcgtacagttcc
agccaggacccacctgagaagtccatccccatctgtaccctgaagaacttccctaatgcc
atcgagcacaccctgcagtgggctcgggatgagtttgaaggcctcttcaagcagccagca
gaaaatgtcaaccagtacctcacagaccccaagtttgtggagcgaacactgcggctggca
ggcactcagcccttggaggtgctggaggctgtgcagcgcagcctggtgctgcagcgacca
cagacctgggctgactgcgtgacctgggcctgccaccactggcacacccagtactcgaac
aacatccggcagctgctgcacaacttccctcctgaccagctcacaagctcaggagcgccg
ttctggtctgggcccaaacgctgtccacacccgctcacctttgatgtcaacaatcccctg
catctggactatgtgatggctgctgccaacctgtttgcccagacctacgggctgacaggc
tctcaggaccgagctgctgtggccacattcctgcagtctgtgcaggtccccgaattcacc
cccaagtctggcgtcaagatccatgtttctgaccaggagctgcagagcgccaatgcctct
gttgatgacagtcgtctagaggagctcaaagccactctgcccagcccagacaagctccct
ggattcaagatgtaccccattgactttgagaaggatgatgacagcaactttcatatggat
ttcatcgtggctgcatccaacctccgggcagaaaactatgacattccttctgcagaccgg
cacaagagcaagctgattgcagggaagatcatcccagccattgccacgaccacagcagcc
gtggttggccttgtgtgtctggagctgtacaaggttgtgcaggggcaccgacagcttgac
tcctacaagaatggtttcctcaacttggccctgcctttctttggtttctctgaacccctt
gccgcaccacgtcaccagtactataaccaagagtggacattgtgggatcgctttgaggta
caagggctgcagcctaatggtgaggagatgaccctcaaacagttcctcgactattttaag
acagagcacaaattagagatcaccatgctgtcccagggcgtgtccatgctctattccttc
ttcatgccagctgccaagctcaaggaacggttggatcagccgatgacagagattgtgagc
cgtgtgtcgaagcgaaagctgggccgccacgtgcgggcgctggtgcttgagctgtgctgt
aacgacgagagcggcgaggatgtcgaggttccctatgtccgatacaccatccgctga

DBGET integrated database retrieval system