KEGG   Homo sapiens (human): 7337Help
Entry
7337              CDS       T01001                                 

Gene name
UBE3A, ANCR, AS, E6-AP, EPVE6AP, HPVE6A
Definition
ubiquitin protein ligase E3A (EC:6.3.2.19)
Orthology
K10587  
ubiquitin-protein ligase E3 A [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Viral carcinogenesis
Disease
H00478  
Prader-Willi and Angelman syndromes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7337 (UBE3A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7337 (UBE3A)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     7337 (UBE3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q11.2
AA seq 875 aa AA seqDB search
MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTF
LRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARI
DFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKS
LQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIR
RVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPE
YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRN
LVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNK
KGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTC
PFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRL
EMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFW
FNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQ
SLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDY
ILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGY
TRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTS
HTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgcaccagtgttattggaaatcaggagaacctcagtctgacgacattgaa
gctagccgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccaccagtta
actgagggctgtggaaatgaagcctgcacgaatgagttttgtgcttcctgtccaactttt
cttcgtatggataataatgcagcagctattaaagccctcgagctttataagattaatgca
aaactctgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcg
aaaggtgcccccaacaactcctgctctgagataaaaatgaacaagaaaggcgctagaatt
gattttaaagatgtgacttacttaacagaagagaaggtatatgaaattcttgaattatgt
agagaaagagaggattattcccctttaatccgtgttattggaagagttttttctagtgct
gaggcattggtacagagcttccggaaagttaaacaacacaccaaggaagaactgaaatct
cttcaagcaaaagatgaagacaaagatgaagatgaaaaggaaaaagctgcatgttctgct
gctgctatggaagaagactcagaagcatcttcctcaaggataggtgatagctcacaggga
gacaacaatttgcaaaaattaggccctgatgatgtgtctgtggatattgatgccattaga
agggtctacaccagattgctctctaatgaaaaaattgaaactgcctttctcaatgcactt
gtatatttgtcacctaacgtggaatgtgacttgacgtatcacaatgtatactctcgagat
cctaattatctgaatttgttcattatcgtaatggagaatagaaatctccacagtcctgaa
tatctggaaatggctttgccattattttgcaaagcgatgagcaagctaccccttgcagcc
caaggaaaactgatcagactgtggtctaaatacaatgcagaccagattcggagaatgatg
gagacatttcagcaacttattacttataaagtcataagcaatgaatttaacagtcgaaat
ctagtgaatgatgatgatgccattgttgctgcttcgaagtgcttgaaaatggtttactat
gcaaatgtagtgggaggggaagtggacacaaatcacaatgaagaagatgatgaagagccc
atccctgagtccagcgagctgacacttcaggaacttttgggagaagaaagaagaaacaag
aaaggtcctcgagtggaccccctggaaactgaacttggtgttaaaaccctggattgtcga
aaaccacttatcccttttgaagagtttattaatgaaccactgaatgaggttctagaaatg
gataaagattatacttttttcaaagtagaaacagagaacaaattctcttttatgacatgt
ccctttatattgaatgctgtcacaaagaatttgggattatattatgacaatagaattcgc
atgtacagtgaacgaagaatcactgttctctacagcttagttcaaggacagcagttgaat
ccatatttgagactcaaagttagacgtgaccatatcatagatgatgcacttgtccggcta
gagatgatcgctatggaaaatcctgcagacttgaagaagcagttgtatgtggaatttgaa
ggagaacaaggagttgatgagggaggtgtttccaaagaattttttcagctggttgtggag
gaaatcttcaatccagatattggtatgttcacatacgatgaatctacaaaattgttttgg
tttaatccatcttcttttgaaactgagggtcagtttactctgattggcatagtactgggt
ctggctatttacaataactgtatactggatgtacattttcccatggttgtctacaggaag
ctaatggggaaaaaaggaacttttcgtgacttgggagactctcacccagttctatatcag
agtttaaaagatttattggagtatgaagggaatgtggaagatgacatgatgatcactttc
cagatatcacagacagatctttttggtaacccaatgatgtatgatctaaaggaaaatggt
gataaaattccaattacaaatgaaaacaggaaggaatttgtcaatctttattctgactac
attctcaataaatcagtagaaaaacagttcaaggcttttcggagaggttttcatatggtg
accaatgaatctcccttaaagtacttattcagaccagaagaaattgaattgcttatatgt
ggaagccggaatctagatttccaagcactagaagaaactacagaatatgacggtggctat
accagggactctgttctgattagggagttctgggaaatcgttcattcatttacagatgaa
cagaaaagactcttcttgcagtttacaacgggcacagacagagcacctgtgggaggacta
ggaaaattaaagatgattatagccaaaaatggcccagacacagaaaggttacctacatct
catacttgctttaatgtgcttttacttccggaatactcaagcaaagaaaaacttaaagag
agattgttgaaggccatcacgtatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system