KEGG   Homo sapiens (human): 7389Help
Entry
7389              CDS       T01001                                 

Gene name
UROD, PCT, UPD
Definition
uroporphyrinogen decarboxylase (EC:4.1.1.37)
Orthology
K01599  
uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Disease
H00202  
Hepatic porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    7389 (UROD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     7389 (UROD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34
AA seq 367 aa AA seqDB search
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaatgggttgggacctcagggttttccggagctgaagaatgacacattcctg
cgagcagcctggggagaggaaacagactacactcccgtttggtgcatgcgccaggcaggc
cgttacttaccagagtttagggaaacccgggctgcccaggactttttcagcacgtgtcgc
tctcctgaggcctgctgtgaactgactctgcagccactgcgtcgcttccctctggatgct
gccatcattttctccgacatccttgttgtaccccaggcactgggcatggaggtgaccatg
gtacctggcaaaggacccagcttcccagagccattaagagaagagcaggacctagaacgc
ctacgggatccagaagtggtagcctctgagctaggctatgtgttccaagccatcaccctt
acccgacaacgactggctggacgtgtgccgctgattggctttgctggtgccccatggacc
ctgatgacatacatggttgagggtggtggctcaagcaccatggctcaggccaagcgctgg
ctctatcagagacctcaggctagtcaccagctgcttcgcatcctcactgatgctctggtc
ccatatctggtaggacaagtggtggctggtgcccaggcattgcagctgtttgagtcccat
gcagggcatcttggcccacagctcttcaacaagtttgcactgccttacatccgtgatgtg
gccaagcaagtgaaggccaggttgcgggaggcaggcctggcaccagtgcccatgatcatc
tttgctaaggatgggcattttgccctggaggagctggcccaagctggctatgaggtggtt
gggcttgactggacagtggccccaaagaaagcccgggagtgtgtggggaagacggtgaca
ttgcagggcaacctggacccctgtgccttgtatgcatctgaggaggagatcgggcagttg
gtgaagcagatgctggatgactttggaccacatcgctacattgccaacctgggccatggg
ctttatcctgacatggacccagaacatgtgggcgcctttgtggatgctgtgcataaacac
tcacgtctgcttcgacagaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system