KEGG   Homo sapiens (human): 7443Help
Entry
7443              CDS       T01001                                 

Gene name
VRK1, PCH1, PCH1A
Definition
vaccinia related kinase 1 (EC:2.7.11.1)
Orthology
K08816  
vaccinia related kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00897  
Pontocerebellar hypoplasia
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7443 (VRK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CK1 group
  VRK family
   7443 (VRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32
AA seq 396 aa AA seqDB search
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
EIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtgtaaaagcagctcaagctggaagacagagctctgcaaagagacatcttgca
gaacaatttgcagttggagagataataactgacatggcaaaaaaggaatggaaagtagga
ttacccattggccaaggaggctttggctgtatatatcttgctgatatgaattcttcagag
tcagttggcagtgatgcaccttgtgttgtaaaagtggaacccagtgacaatggacctctt
tttactgaattaaagttctaccaacgagctgcaaaaccagagcaaattcagaaatggatt
cgtacccgtaagctgaagtacctgggtgttcctaagtattgggggtctggtctacatgac
aaaaatggaaaaagttacaggtttatgataatggatcgctttgggagtgaccttcagaaa
atatatgaagcaaatgccaaaaggttttctcggaaaactgtcttgcagctaagcttaaga
attctggatattctggaatatattcacgagcatgagtatgtgcatggagatatcaaggcc
tcaaatcttcttctgaactacaagaatcctgaccaggtgtacttggtagattatggcctt
gcttatcggtactgcccagaaggagttcataaagaatacaaagaagaccccaaaagatgt
cacgatggcactattgaattcacgagcatcgatgcacacaatggcgtggccccatcaaga
cgtggtgatttggaaatacttggttattgcatgatccaatggcttactggccatcttcct
tgggaggataatttgaaagatcctaaatatgttagagattccaaaattagatacagagaa
aatattgcaagtttgatggacaaatgttttcctgagaaaaacaaaccaggtgaaattgcc
aaatacatggaaacagtgaaattactagactacactgaaaaacctctttatgaaaattta
cgtgacattcttttgcaaggactaaaagctataggaagtaaggatgatggcaaattggac
ctcagtgttgtggagaatggaggtttgaaagcaaaaacaataacaaagaagcgaaagaaa
gaaattgaagaaagcaaggaacctggtgttgaagatacggaatggtcaaacacacagaca
gaggaggccatacagacccgttcaagaaccagaaagagagtccagaagtaa

DBGET integrated database retrieval system