KEGG   Homo sapiens (human): 7486Help
Entry
7486              CDS       T01001                                 

Gene name
WRN, RECQ3, RECQL2, RECQL3
Definition
(RefSeq) Werner syndrome RecQ like helicase
  KO
K10900  
werner syndrome ATP-dependent helicase [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Disease
H00296  
Defects in RecQ helicases
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     7486 (WRN)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    7486 (WRN)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     7486 (WRN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 1432 aa AA seqDB search
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDAS
DCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVF
PQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAIN
KEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMII
GSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK
STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLE
NLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCL
KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLIS
LMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADI
GITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNL
RNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQV
TGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG
APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME
KYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFG
PQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSR
QLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSK
TVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSS
SQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKR
IDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVI
RNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEE
ICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaaaattggaaacaactgcacagcagcggaaatgtcctgaatggatgaat
gtgcagaataaaagatgtgctgtagaagaaagaaaggcatgtgttcggaagagtgttttt
gaagatgacctccccttcttagaattcactggatccattgtgtatagttacgatgctagt
gattgctctttcctgtcagaagatattagcatgagtctatcagatggggatgtggtggga
tttgacatggagtggccaccattatacaatagagggaaacttggcaaagttgcactaatt
cagttgtgtgtttctgagagcaaatgttacttgttccacgtttcttccatgtcagttttt
ccccagggattaaaaatgttgcttgaaaataaagcagttaaaaaggcaggtgtaggaatt
gaaggagatcagtggaaacttctacgtgactttgatatcaaattgaagaattttgtggag
ttgacagatgttgccaataaaaagctgaaatgcacagagacctggagccttaacagtctg
gttaaacacctcttaggtaaacagctcctgaaagacaagtctatccgctgtagcaattgg
agtaaatttcctctcactgaggaccagaaactgtatgcagccactgatgcttatgctggt
tttattatttaccgaaatttagagattttggatgatactgtgcaaaggtttgctataaat
aaagaggaagaaatcctacttagcgacatgaacaaacagttgacttcaatctctgaggaa
gtgatggatctggctaagcatcttcctcatgctttcagtaaattggaaaacccacggagg
gtttctatcttactaaaggatatttcagaaaatctatattcactgaggaggatgataatt
gggtctactaacattgagactgaactgaggcccagcaataatttaaacttattatccttt
gaagattcaactactgggggagtacaacagaaacaaattagagaacatgaagttttaatt
cacgttgaagatgaaacatgggacccaacacttgatcatttagctaaacatgatggagaa
gatgtacttggaaataaagtggaacgaaaagaagatggatttgaagatggagtagaagac
aacaaattgaaagagaatatggaaagagcttgtttgatgtcgttagatattacagaacat
gaactccaaattttggaacagcagtctcaggaagaatatcttagtgatattgcttataaa
tctactgagcatttatctcccaatgataatgaaaacgatacgtcctatgtaattgagagt
gatgaagatttagaaatggagatgcttaagcatttatctcccaatgataatgaaaacgat
acgtcctatgtaattgagagtgatgaagatttagaaatggagatgcttaagtctttagaa
aacctcaatagtggcacggtagaaccaactcattctaaatgcttaaaaatggaaagaaat
ctgggtcttcctactaaagaagaagaagaagatgatgaaaatgaagctaatgaaggggaa
gaagatgatgataaggactttttgtggccagcacccaatgaagagcaagttacttgcctc
aagatgtactttggccattccagttttaaaccagttcagtggaaagtgattcattcagta
ttagaagaaagaagagataatgttgctgtcatggcaactggatatggaaagagtttgtgc
ttccagtatccacctgtttatgtaggcaagattggccttgttatctctccccttatttct
ctgatggaagaccaagtgctacagcttaaaatgtccaacatcccagcttgcttccttgga
tcagcacagtcagaaaatgttctaacagatattaaattaggtaaataccggattgtatac
gtaactccagaatactgttcaggtaacatgggcctgctccagcaacttgaggctgatatt
ggtatcacgctcattgctgtggatgaggctcactgtatttctgagtgggggcatgatttt
agggattcattcaggaagttgggctccctaaagacagcactgccaatggttccaatcgtt
gcacttactgctactgcaagttcttcaatccgggaagacattgtacgttgcttaaatctg
agaaatcctcagatcacctgtactggttttgatcgaccaaacctgtatttagaagttagg
cgaaaaacagggaatatccttcaggatctgcagccatttcttgtcaaaacaagttcccac
tgggaatttgaaggtccaacaatcatctactgtccttctagaaaaatgacacaacaagtt
acaggtgaacttaggaaactgaatctatcctgtggaacataccatgcgggcatgagtttt
agcacaaggaaagacattcatcataggtttgtaagagatgaaattcagtgtgtcatagct
accatagcttttggaatgggcattaataaagctgacattcgccaagtcattcattacggt
gctcctaaggacatggaatcatattatcaggagattggtagagctggtcgtgatggactt
caaagttcttgtcacgtcctctgggctcctgcagacattaacttaaataggcaccttctt
actgagatacgtaatgagaagtttcgattatacaaattaaagatgatggcaaagatggaa
aaatatcttcattctagcagatgtaggagacaaatcatcttgtctcattttgaggacaaa
caagtacaaaaagcctccttgggaattatgggaactgaaaaatgctgtgataattgcagg
tccagattggatcattgctattccatggatgactcagaggatacatcctgggactttggt
ccacaagcatttaagcttttgtctgctgtggacatcttaggcgaaaaatttggaattggg
cttccaattttatttctccgaggatctaattctcagcgtcttgccgatcaatatcgcagg
cacagtttatttggcactggcaaggatcaaacagagagttggtggaaggctttttcccgt
cagctgatcactgagggattcttggtagaagtttctcggtataacaaatttatgaagatt
tgcgcccttacgaaaaagggtagaaattggcttcataaagctaatacagaatctcagagc
ctcatccttcaagctaatgaagaattgtgtccaaagaagttgcttctgcctagttcgaaa
actgtatcttcgggcaccaaagagcattgttataatcaagtaccagttgaattaagtaca
gagaagaagtctaacttggagaagttatattcttataaaccatgtgataagatttcttct
gggagtaacatttctaaaaaaagtatcatggtacagtcaccagaaaaagcttacagttcc
tcacagcctgttatttcggcacaagagcaggagactcagattgtgttatatggcaaattg
gtagaagctaggcagaaacatgccaataaaatggatgttcccccagctattctggcaaca
aacaagatactggtggatatggccaaaatgagaccaactacggttgaaaacgtaaaaagg
attgatggtgtttctgaaggcaaagctgccatgttggcccctctgttggaagtcatcaaa
catttctgccaaacaaatagtgttcagacagacctcttttcaagtacaaaacctcaagaa
gaacagaagacgagtctggtagcaaaaaataaaatatgcacactttcacagtctatggcc
atcacatactctttattccaagaaaagaagatgcctttgaagagcatagctgagagcagg
attctgcctctcatgacaattggcatgcacttatcccaagcggtgaaagctggctgcccc
cttgatttggagcgagcaggcctgactccagaggttcagaagattattgctgatgttatc
cgaaaccctcccgtcaactcagatatgagtaaaattagcctaatcagaatgttagttcct
gaaaacattgacacgtaccttatccacatggcaattgagatccttaaacatggtcctgac
agcggacttcaaccttcatgtgatgtcaacaaaaggagatgttttcccggttctgaagag
atctgttcaagttctaagagaagcaaggaagaagtaggcatcaatactgagacttcatct
gcagagagaaagagacgattacctgtgtggtttgccaaaggaagtgataccagcaagaaa
ttaatggacaaaacgaaaaggggaggtctttttagttaa

DBGET integrated database retrieval system