KEGG   Homo sapiens (human): 7486Help
Entry
7486              CDS       T01001                                 

Gene name
WRN, RECQ3, RECQL2, RECQL3
Definition
Werner syndrome, RecQ helicase-like (EC:3.6.4.12)
Orthology
K10900  
werner syndrome ATP-dependent helicase [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Disease
H00296  
Defects in RecQ helicases
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     7486 (WRN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 1432 aa AA seqDB search
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDAS
DCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVF
PQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAIN
KEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMII
GSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK
STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLE
NLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCL
KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLIS
LMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADI
GITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNL
RNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQV
TGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG
APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME
KYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFG
PQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSR
QLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSK
TVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSS
SQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKR
IDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVI
RNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEE
ICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaaaattggaaacaactgcacagcagcggaaatgtcctgaatggatgaat
gtgcagaataaaagatgtgctgtagaagaaagaaaggcatgtgttcggaagagtgttttt
gaagatgacctccccttcttagaattcactggatccattgtgtatagttacgatgctagt
gattgctctttcctgtcagaagatattagcatgagtctatcagatggggatgtggtggga
tttgacatggagtggccaccattatacaatagagggaaacttggcaaagttgcactaatt
cagttgtgtgtttctgagagcaaatgttacttgttccacgtttcttccatgtcagttttt
ccccagggattaaaaatgttgcttgaaaataaagcagttaaaaaggcaggtgtaggaatt
gaaggagatcagtggaaacttctacgtgactttgatatcaaattgaagaattttgtggag
ttgacagatgttgccaataaaaagctgaaatgcacagagacctggagccttaacagtctg
gttaaacacctcttaggtaaacagctcctgaaagacaagtctatccgctgtagcaattgg
agtaaatttcctctcactgaggaccagaaactgtatgcagccactgatgcttatgctggt
tttattatttaccgaaatttagagattttggatgatactgtgcaaaggtttgctataaat
aaagaggaagaaatcctacttagcgacatgaacaaacagttgacttcaatctctgaggaa
gtgatggatctggctaagcatcttcctcatgctttcagtaaattggaaaacccacggagg
gtttctatcttactaaaggatatttcagaaaatctatattcactgaggaggatgataatt
gggtctactaacattgagactgaactgaggcccagcaataatttaaacttattatccttt
gaagattcaactactgggggagtacaacagaaacaaattagagaacatgaagttttaatt
cacgttgaagatgaaacatgggacccaacacttgatcatttagctaaacatgatggagaa
gatgtacttggaaataaagtggaacgaaaagaagatggatttgaagatggagtagaagac
aacaaattgaaagagaatatggaaagagcttgtttgatgtcgttagatattacagaacat
gaactccaaattttggaacagcagtctcaggaagaatatcttagtgatattgcttataaa
tctactgagcatttatctcccaatgataatgaaaacgatacgtcctatgtaattgagagt
gatgaagatttagaaatggagatgcttaagcatttatctcccaatgataatgaaaacgat
acgtcctatgtaattgagagtgatgaagatttagaaatggagatgcttaagtctttagaa
aacctcaatagtggcacggtagaaccaactcattctaaatgcttaaaaatggaaagaaat
ctgggtcttcctactaaagaagaagaagaagatgatgaaaatgaagctaatgaaggggaa
gaagatgatgataaggactttttgtggccagcacccaatgaagagcaagttacttgcctc
aagatgtactttggccattccagttttaaaccagttcagtggaaagtgattcattcagta
ttagaagaaagaagagataatgttgctgtcatggcaactggatatggaaagagtttgtgc
ttccagtatccacctgtttatgtaggcaagattggccttgttatctctccccttatttct
ctgatggaagaccaagtgctacagcttaaaatgtccaacatcccagcttgcttccttgga
tcagcacagtcagaaaatgttctaacagatattaaattaggtaaataccggattgtatac
gtaactccagaatactgttcaggtaacatgggcctgctccagcaacttgaggctgatatt
ggtatcacgctcattgctgtggatgaggctcactgtatttctgagtgggggcatgatttt
agggattcattcaggaagttgggctccctaaagacagcactgccaatggttccaatcgtt
gcacttactgctactgcaagttcttcaatccgggaagacattgtacgttgcttaaatctg
agaaatcctcagatcacctgtactggttttgatcgaccaaacctgtatttagaagttagg
cgaaaaacagggaatatccttcaggatctgcagccatttcttgtcaaaacaagttcccac
tgggaatttgaaggtccaacaatcatctactgtccttctagaaaaatgacacaacaagtt
acaggtgaacttaggaaactgaatctatcctgtggaacataccatgcgggcatgagtttt
agcacaaggaaagacattcatcataggtttgtaagagatgaaattcagtgtgtcatagct
accatagcttttggaatgggcattaataaagctgacattcgccaagtcattcattacggt
gctcctaaggacatggaatcatattatcaggagattggtagagctggtcgtgatggactt
caaagttcttgtcacgtcctctgggctcctgcagacattaacttaaataggcaccttctt
actgagatacgtaatgagaagtttcgattatacaaattaaagatgatggcaaagatggaa
aaatatcttcattctagcagatgtaggagacaaatcatcttgtctcattttgaggacaaa
caagtacaaaaagcctccttgggaattatgggaactgaaaaatgctgtgataattgcagg
tccagattggatcattgctattccatggatgactcagaggatacatcctgggactttggt
ccacaagcatttaagcttttgtctgctgtggacatcttaggcgaaaaatttggaattggg
cttccaattttatttctccgaggatctaattctcagcgtcttgccgatcaatatcgcagg
cacagtttatttggcactggcaaggatcaaacagagagttggtggaaggctttttcccgt
cagctgatcactgagggattcttggtagaagtttctcggtataacaaatttatgaagatt
tgcgcccttacgaaaaagggtagaaattggcttcataaagctaatacagaatctcagagc
ctcatccttcaagctaatgaagaattgtgtccaaagaagttgcttctgcctagttcgaaa
actgtatcttcgggcaccaaagagcattgttataatcaagtaccagttgaattaagtaca
gagaagaagtctaacttggagaagttatattcttataaaccatgtgataagatttcttct
gggagtaacatttctaaaaaaagtatcatggtacagtcaccagaaaaagcttacagttcc
tcacagcctgttatttcggcacaagagcaggagactcagattgtgttatatggcaaattg
gtagaagctaggcagaaacatgccaataaaatggatgttcccccagctattctggcaaca
aacaagatactggtggatatggccaaaatgagaccaactacggttgaaaacgtaaaaagg
attgatggtgtttctgaaggcaaagctgccatgttggcccctctgttggaagtcatcaaa
catttctgccaaacaaatagtgttcagacagacctcttttcaagtacaaaacctcaagaa
gaacagaagacgagtctggtagcaaaaaataaaatatgcacactttcacagtctatggcc
atcacatactctttattccaagaaaagaagatgcctttgaagagcatagctgagagcagg
attctgcctctcatgacaattggcatgcacttatcccaagcggtgaaagctggctgcccc
cttgatttggagcgagcaggcctgactccagaggttcagaagattattgctgatgttatc
cgaaaccctcccgtcaactcagatatgagtaaaattagcctaatcagaatgttagttcct
gaaaacattgacacgtaccttatccacatggcaattgagatccttaaacatggtcctgac
agcggacttcaaccttcatgtgatgtcaacaaaaggagatgttttcccggttctgaagag
atctgttcaagttctaagagaagcaaggaagaagtaggcatcaatactgagacttcatct
gcagagagaaagagacgattacctgtgtggtttgccaaaggaagtgataccagcaagaaa
ttaatggacaaaacgaaaaggggaggtctttttagttaa

DBGET integrated database retrieval system