KEGG   Homo sapiens (human): 7531Help
Entry
7531              CDS       T01001                                 

Gene name
YWHAE, 14-3-3E, HEL2, KCIP-1, MDCR, MDS
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon
Orthology
K06630  
14-3-3 protein epsilon
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Neurotrophin signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Disease
H00268  
Lissencephaly (LIS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7531 (YWHAE)
   04151 PI3K-Akt signaling pathway
    7531 (YWHAE)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7531 (YWHAE)
   04114 Oocyte meiosis
    7531 (YWHAE)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    7531 (YWHAE)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7531 (YWHAE)
  Infectious diseases
   05169 Epstein-Barr virus infection
    7531 (YWHAE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7531 (YWHAE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 255 aa AA seqDB search
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcgagaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaagtagcagggatggatgtggagctgacagttgaa
gaaagaaacctcctatctgttgcatataagaatgtgattggagctagaagagcctcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaagctaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggcagaatttgccacaggaaacgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatcctattcgcttaggtcttgctctcaatttttccgtattc
tactacgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgacggtgaa
gagcagaataaagaagcgctgcaggacgtggaagacgaaaatcagtga

DBGET integrated database retrieval system