KEGG   Homo sapiens (human): 7840Help
Entry
7840              CDS       T01001                                 

Gene name
ALMS1, ALSS
Definition
Alstrom syndrome 1
Orthology
K16741  
alstrom syndrome protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00417  
Alstrom syndrome (AS)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13
AA seq 4169 aa AA seqDB search
MEPEDLPWPGELEEEEEEEEEEEEEEEEEAAAAAAANVDDVVVVEEVEEEAGRELDSDSH
YGPQHLESIDDEEDEEAKAWLQAHPGRILPPLSPPQHRYSEGERTSLEKIVPLTCHVWQQ
IVYQGNSRTQISDTNVVCLETTAQRGSGDDQKTESWHCLPQEMDSSQTLDTSQTRFNVRT
EDTEVTDFPSLEEGILTQSENQVKEPNRDLFCSPLLVIQDSFASPDLPLLTCLTQDQEFA
PDSLFHQSELSFAPLRGIPDKSEDTEWSSRPSEVSEALFQATAEVASDLASSRFSVSQHP
LIGSTAVGSQCPFLPSEQGNNEETISSVDELKIPKDCDRYDDLCSYMSWKTRKDTQWPEN
NLADKDQVSVATSFDITDENIATKRSDHFDAARSYGQYWTQEDSSKQAETYLTKGLQGKV
ESDVITLDGLNENAVVCSERVAELQRKPTRESEYHSSDLRMLRMSPDTVPKAPKHLKAGD
TSKGGIAKVTQSNLKSGITTTPVDSDIGSHLSLSLEDLSQLAVSSPLETTTGQHTDTLNQ
KTLADTHLTEETLKVTAIPEPADQKTATPTVLSSSHSHRGKPSIFYQQGLPDSHLTEEAL
KVSAAPGLADQTTGMSTLTSTSYSHREKPGTFYQQELPESNLTEEPLEVSAAPGPVEQKT
GIPTVSSTSHSHVEDLLFFYRQTLPDGHLTDQALKVSAVSGPADQKTGTATVLSTPHSHR
EKPGIFYQQEFADSHQTEETLTKVSATPGPADQKTEIPAVQSSSYSQREKPSILYPQDLA
DSHLPEEGLKVSAVAGPADQKTGLPTVPSSAYSHREKLLVFYQQALLDSHLPEEALKVSA
VSGPADGKTGTPAVTSTSSASSSLGEKPSAFYQQTLPNSHLTEEALKVSIVPGPGDQKTG
IPSAPSSFYSHREKPIIFSQQTLPDFLFPEEALKVSAVSVLAAQKTGTPTVSSNSHSHSE
KSSVFYQQELPDSDLPRESLKMSAIPGLTDQKTVPTPTVPSGSFSHREKPSIFYQQEWPD
SYATEKALKVSTGPGPADQKTEIPAVQSSSYPQREKPSVLYPQVLSDSHLPEESLKVSAF
PGPADQMTDTPAVPSTFYSQREKPGIFYQQTLPESHLPKEALKISVAPGLADQKTGTPTV
TSTSYSQHREKPSIFHQQALPGTHIPEEAQKVSAVTGPGNQKTWIPRVLSTFYSQREKPG
IFYQQTLPGSHIPEEAQKVSPVLGPADQKTGTPTPTSASYSHTEKPGIFYQQVLPDNHPT
EEALKISVASEPVDQTTGTPAVTSTSYSQYREKPSIFYQQSLPSSHLTEEAKNVSAVPGP
ADQKTVIPILPSTFYSHTEKPGVFYQQVLPHSHPTEEALKISVASEPVDQTTGTPTVTST
SYSQHTEKPSIFYQQSLPGSHLTEEAKNVSAVPGPGDRKTGIPTLPSTFYSHTEKPGSFY
QQVLPHSHLPEEALEVSVAPGPVDQTIGTPTVTSPSSSFGEKPIVIYKQAFPEGHLPEES
LKVSVAPGPVGQTTGAPTITSPSYSQHRAKSGSFYQLALLGSQIPEEALRVSSAPGPADQ
TTGIPTITSTSYSFGEKPIVNYKQAFPDGHLPEEALKVSIVSGPTEKKTDIPAGPLGSSA
LGEKPITFYRQALLDSPLNKEVVKVSAAPGPADQKTETLPVHSTSYSNRGKPVIFYQQTL
SDSHLPEEALKVPPVPGPDAQKTETPSVSSSLYSYREKPIVFYQQALPDSELTQEALKVS
AVPQPADQKTGLSTVTSSFYSHTEKPNISYQQELPDSHLTEEALKVSNVPGPADQKTGVS
TVTSTSYSHREKPIVSYQRELPHFTEAGLKILRVPGPADQKTGINILPSNSYPQREHSVI
SYEQELPDLTEVTLKAIGVPGPADQKTGIQIASSSSYSNREKASIFHQQELPDVTEEALN
VFVVPGQGDRKTEIPTVPLSYYSRREKPSVISQQELPDSHLTEEALKVSPVSIPAEQKTG
IPIGLSSSYSHSHKEKLKISTVHIPDDQKTEFPAATLSSYSQIEKPKISTVIGPNDQKTP
SQTAFHSSYSQTVKPNILFQQQLPDRDQSKGILKISAVPELTDVNTGKPVSLSSSYFHRE
KSNIFSPQELPGSHVTEDVLKVSTIPGPAGQKTVLPTALPSSFSHREKPDIFYQKDLPDR
HLTEDALKISSALGQADQITGLQTVPSGTYSHGENHKLVSEHVQRLIDNLNSSDSSVSSN
NVLLNSQADDRVVINKPESAGFRDVGSEEIQDAENSAKTLKEIRTLLMEAENMALKRCNF
PAPLARFRDISDISFIQSKKVVCFKEPSSTGVSNGDLLHRQPFTEESPSSRCIQKDIGTQ
TNLKCRRGIENWEFISSTTVRSPLQEAESKVSMALEETLRQYQAAKSVMRSEPEGCSGTI
GNKIIIPMMTVIKSDSSSDASDGNGSCSWDSNLPESLESVSDVLLNFFPYVSPKTSITDS
REEEGVSESEDGGGSSVDSLAAHVKNLLQCESSLNHAKEILRNAEEEESRVRAHAWNMKF
NLAHDCGYSISELNEDDRRKVEEIKAELFGHGRTTDLSKGLQSPRGMGCKPEAVCSHIII
ESHEKGCFRTLTSEHPQLDRHPCAFRSAGPSEMTRGRQNPSSCRAKHVNLSASLDQNNSH
FKVWNSLQLKSHSPFQNFIPDEFKISKGLRMPFDEKMDPWLSELVEPAFVPPKEVDFHSS
SQMPSPEPMKKFTTSITFSSHRHSKCISNSSVVKVGVTEGSQCTGASVGVFNSHFTEEQN
PPRDLKQKTSSPSSFKMHSNSQDKEVTILAEGRRQSQKLPVDFERSFQEEKPLERSDFTG
SHSEPSTRANCSNFKEIQISDNHTLISMGRPSSTLGVNRSSSRLGVKEKNVTITPDLPSC
IFLEQRELFEQSKAPRADDHVRKHHSPSPQHQDYVAPDLPSCIFLEQRELFEQCKAPYVD
HQMRENHSPLPQGQDSIASDLPSPISLEQCQSKAPGVDDQMNKHHFPLPQGQDCVVEKNN
QHKPKSHISNINVEAKFNTVVSQSAPNHCTLAASASTPPSNRKALSCVHITLCPKTSSKL
DSGTLDERFHSLDAASKARMNSEFNFDLHTVSSRSLEPTSKLLTSKPVAQDQESLGFLGP
KSSLDFQVVQPSLPDSNTITQDLKTIPSQNSQIVTSRQIQVNISDFEGHSNPEGTPVFAD
RLPEKMKTPLSAFSEKLSSDAVTQITTESPEKTLFSSEIFINAEDRGHEIIEPGNQKLRK
APVKFASSSSVQQVTFSRGTDGQPLLLPYKPSGSTKMYYVPQLRQIPPSPDSKSDTTVES
SHSGSNDAIAPDFPAQVLGTRDDDLSATVNIKHKEGIYSKRVVTKASLPVGEKPLQNENA
DASVQVLITGDENLSDKKQQEIHSTRAVTEAAQAKEKESLQKDTADSSAAAAAEHSAQVG
DPEMKNLPDTKAITQKEEIHRKKTVPEEAWPNNKESLQINIEESECHSEFENTTRSVFRS
AKFYIHHPVHLPSDQDICHESLGKSVFMRHSWKDFFQHHPDKHREHMCLPLPYQNMDKTK
TDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTPEQTTQHTVSLN
ELWNKYRERQRQQRQPELGDRKELSLVDRLDRLAKILQNPITHSLQVSESTHDDSRGERS
VKEWSGRQQQRNKLQKKKRFKSLEKSHKNTGELKKSKVLSHHRAGRSNQIKIEQIKFDKY
ILSKQPGFNYISNTSSDCRPSEESELLTDTTTNILSGTTSTVESDILTQTDREVALHERS
SSVSTIDTARLIQAFGHERVCLSPRRIKLYSSITNQQRRYLEKRSKHSKKVLNTGHPLVT
SEHTRRRHIQVANHVISSDSISSSASSFLSSNSTFCNKQNVHMLNKGIQAGNLEIVNGAK
KHTRDVGITFPTPSSSEAKLEENSDVTSWSEEKREEKMLFTGYPEDRKLKKNKKNSHEGV
SWFVPVENVESRSKKENVPNTCGPGISWFEPITKTRPWREPLREQNCQGQHLDGRGYLAG
PGREAGRDLLRPFVRATLQESLQFHRPDFISRSGERIKRLKLIVQERKLQSMLQTERDAL
FNIDRERQGHQNRMCPLPKRVFLAIQKNKPISKKEMIQRSKRIYEQLPEVQKKREEEKRK
SEYKSYRLRAQLYKKRVTNQLLGRKVPWD
NT seq 12510 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgaggatctgccatggccgggcgagctggaggaggaggaggaggaggaggag
gaggaggaggaggaggaagaggaggaggctgcagcggcggcggcggcgaacgtggacgac
gtagtggtcgtggaggaggtggaggaagaggcggggcgggagttggactccgactctcac
tacgggccccagcatctggaaagtatagacgacgaggaggacgaggaggccaaggcctgg
ctgcaggcgcaccccggcaggattttgcctccgctgtcgcccccgcagcaccgctactcg
gagggcgagcggacctccctggagaagattgttccattgacctgtcatgtatggcaacag
atagtatatcaaggcaatagtagaacacaaatttctgatactaatgtggtctgtttggaa
acaacagctcagcggggttctggggatgatcagaaaacagaatcttggcattgtcttcct
caagaaatggactcttcccaaaccttggatacatcccagactaggtttaatgtgagaacg
gaagatactgaagtgacagacttcccctctctggaggagggcatattgacgcaatcagaa
aatcaagtaaaggaacccaacagagatctcttctgttctccactgctagtcatacaagat
agctttgcttctcctgatttgcctttgctgacctgtttgacacaagaccaagaatttgcg
cctgattctttatttcatcaaagtgaactaagttttgcacctctgaggggaattcctgat
aagtctgaagatactgaatggtcttctcgaccatcggaagttagtgaagctttattccag
gctactgcagaagtagcttcagacttagcaagcagtcgctttagtgtatctcagcacccg
cttataggcagcacagctgttgggtctcagtgcccttttttaccttctgaacaagggaat
aatgaagagactatttcgtctgttgatgaactgaaaattcccaaagactgtgatcgttat
gatgatctttgttcatatatgtcatggaagacacgaaaagatacacagtggcctgaaaac
aatttagctgataaagatcaagtttcagttgcaacttcatttgacataactgatgaaaac
atagctactaaaagaagtgaccattttgatgctgctcgttcatatgggcagtattggaca
caggaagattcatctaagcaggcagaaacatatttaaccaagggcctgcaggggaaggtt
gagtctgacgtcattactctggatggcctaaatgaaaatgctgttgtatgcagtgaaaga
gttgctgaactacaaagaaagccaacaagagagtcggaatatcactcttcagatctcaga
atgttgaggatgtctcctgacactgtgccaaaggctcctaaacatttaaaagcaggagac
acttctaaaggaggcatagctaaagttactcaatccaacttgaagtcaggcatcactacc
actcctgttgattcagacattggatctcatttatccttgtcccttgaggacctgtctcag
ttggctgtaagttctcctctagaaactactactggtcaacacactgatactctcaaccaa
aagacattagcagatactcatctaactgaagagactctgaaagtcacagctattcctgaa
ccagctgaccagaagactgcaacaccaacagtactctctagttcccactcacataggggg
aagcccagcattttctaccagcagggcttgccagacagtcatctaactgaagaggctttg
aaagtttcagctgctcctggactagctgaccagacaactggcatgtcaactctaacctct
acttcctactcacatagagagaagcctggtactttttaccaacaagagttaccagagagt
aacttaaccgaagagcctttggaagtttcagctgctcctggcccagtggagcagaagacg
ggaatacctacagtatcctctacatcccactcacatgtagaggacctcctctttttctat
cgacagaccttgccagatggtcatctaactgatcaggctctgaaagtctcagctgtgtct
ggaccagctgaccagaagactgggacagcaacagtactctctactccccactcacataga
gagaagcctggtattttttaccaacaagagttcgcagacagtcatcaaactgaagagact
cttactaaagtttcagccactcctggaccagctgaccagaagactgagataccagcagta
cagtctagttcttactcacaaagagaaaagcctagtattttgtacccacaggacttagca
gacagtcatctacctgaagagggtctgaaagtttcagctgttgctggaccagctgaccag
aagactggcctaccaacagtaccctctagtgcatactcacacagagagaagctccttgtt
ttctaccaacaggccttgctggacagccatctacccgaagaggctctgaaagtttcagct
gtttctggaccagctgacggaaagactgggacaccagctgtaacctctacttcctctgcg
tcctcttcacttggagaaaagcccagtgctttctatcagcagaccttacccaatagtcat
ctaactgaagaggctctgaaagtatcaattgttcctggaccaggtgatcagaagactggg
ataccctcagcaccatctagtttctactcacacagagagaagcccattattttttcccag
cagaccctgccagactttcttttccctgaagaagctctgaaggtttcagctgtttctgta
ttggctgcccagaagactgggacaccaacagtgtcctctaattctcactcacatagcgag
aaatctagtgttttctaccagcaagagttgccagacagtgatctacctagagaatctctg
aaaatgtctgctattcctggactgactgaccagaagactgtcccaacaccaacagtacct
tcaggttccttctcacatagagagaagcccagtattttctatcaacaggagtggccagat
agttatgcaactgaaaaggctctgaaagtttcaactggccctggaccagctgaccagaag
actgagataccagcagtacagtctagttcttacccacagagggagaagcctagtgttttg
tacccacaggtgttatcagacagtcatctacctgaagagagtctgaaagtttcagccttc
cctggaccagctgaccagatgactgacacaccagcagtaccgtctactttctactcacaa
agagagaagcctggtattttctaccaacagaccttgccagagagtcatctgcctaaagag
gctctgaaaatttcagtagctcctggactagcagaccagaagactggcacaccaactgta
acctcaacttcctactcacaacatagagaaaagcccagcattttccaccagcaggccttg
ccaggtactcatatacctgaagaggctcagaaagtttcagctgttactggaccaggtaac
cagaagacttggataccaagagtactttctaccttctactcacaaagagagaaacctggt
attttctatcaacagaccttgccaggtagtcacatacctgaagaggcacagaaagtttca
cctgttcttggaccagctgaccagaagactgggacaccaactccaacctctgcttcttac
tcacacacagagaagcctggtattttctaccaacaggtcttgccagataatcatccaact
gaagaggctctgaaaatttcagttgcctctgaaccagttgaccagacaactggcacacca
gctgtaacctctacttcctactcacaatatagagagaagcccagcattttctaccaacag
tcgttgccaagtagtcatctaactgaagaggctaagaatgtttcagcggttcctggacca
gctgaccagaagactgtgataccaattttaccctctactttctactcacacacagagaag
cctggtgttttctaccaacaggtcttgccacatagtcatccaactgaagaggctctgaaa
atttcagttgcctctgaaccagttgaccagacaactggcacaccaactgtaacctctact
tcttactcacaacatacagagaagccgagtattttctaccaacagtcgttgccaggtagt
catctaactgaagaggctaagaacgtttcagcggttcctggaccaggtgaccggaagact
gggataccaactttaccctctactttctactcacacacagagaagcctggtagtttctac
caacaggtcttgccacatagtcatctacctgaagaggctttggaagtttcagttgctcct
ggaccagttgaccagacgattggcacaccaactgtaacctccccttccagctcatttgga
gagaagcccattgttatctacaaacaggcctttccagagggtcatctacctgaagagtct
ctgaaagtttcagttgctcctggaccagttggccagacaactggcgcaccaactataacc
tctccttcctactcacaacatagagcaaagtctggcagtttctaccaactggcattgcta
ggtagtcaaatacctgaagaggctctcagagtttcttctgctcctggaccagctgaccag
acaactggcataccaaccataacctctacttcctactcatttggagagaagccgattgtt
aactacaaacaggcctttccagatggtcatctacctgaagaggctctgaaagtttccatt
gtttctggacctactgaaaaaaagactgacataccagcaggacctttaggttccagtgca
cttggagagaagcccattactttctaccggcaggctctgctagacagtcctctaaataaa
gaggttgtgaaagtttcagctgctcctggaccagctgaccagaagactgagacattacca
gtacattctactagctactcaaatagggggaagcctgtcattttctaccagcagacccta
tcagacagtcatttacctgaagaagctctgaaagttccacctgttcctggaccagatgcc
cagaagactgagacaccatcagtatcctctagtttatactcatatagagagaagcccatt
gtcttctaccaacaggccctgccagacagtgagctaactcaagaagctctgaaagtttca
gctgttcctcaaccagctgaccagaagactgggttatctactgtaacttcctctttctat
tcacatacagagaagcctaatatttcttaccagcaagagttgccagatagtcatctaact
gaagaggctctgaaagtttcaaatgttcctggaccagctgaccagaagactggggtatca
acagtaacctctacttcctactcacacagagagaagcccattgtttcctaccagcgagag
ttgccgcattttactgaagcaggtttgaaaattttaagagttcctggaccagctgaccag
aagactggaataaacatcctgccctctaattcctacccacagagagagcactctgtcatt
tcttatgagcaggagttgccagatcttactgaagtaactttgaaagcaataggggttcct
gggcctgctgaccagaagactgggatacaaatagcatcctctagttcctactcaaataga
gagaaggccagtatttttcatcagcaggagttgccagatgttactgaagaagctttaaat
gtttttgttgttcctggacaaggtgaccggaagactgagataccaacagtacctttaagt
tactactcacgtagagagaagcccagtgttatctctcaacaggagttgccagacagtcat
ctcacagaagaggctctgaaagtttcacctgtttctataccagcagagcagaagactggg
ataccaataggactgtctagttcctactcacattcacataaagagaaactcaagatttca
actgtgcatataccagatgaccagaaaactgagtttccagcagctacccttagttcctac
tcacaaatagagaagcccaagatttcaactgtgattggaccaaatgaccagaagactcca
tcccagacagcttttcatagttcctattctcaaacagtaaagcccaatattttatttcaa
cagcagttgccagatagagatcaaagtaaaggtattctaaagatttcagctgtccctgaa
ctaactgatgtgaatactggaaaaccagtatctctctctagttcttattttcacagagag
aaatcgaatattttcagtccacaggaattgccaggtagtcatgtaactgaagatgtgctg
aaggtttcaacaattcctggaccagctggccagaaaacagtattaccaacagctcttcct
agttccttttcacatcgagagaaaccagatattttctatcaaaaggatttgccagataga
catctaactgaagatgctctaaagatctcaagtgctcttgggcaagctgatcaaattacc
ggattacaaacagttccctctggtacttactcacatggtgagaatcacaagcttgtttca
gaacatgtccaaaggctaatagataatttgaattcttctgactccagtgttagctcaaat
aatgtgcttttaaattctcaggctgatgacagagttgtaataaataaaccagaatctgca
ggttttagagatgttggctctgaagaaatccaggatgcagaaaatagtgctaaaactctt
aaggaaattcggacacttttgatggaggcagaaaatatggcactgaaacgatgcaatttt
cctgctccccttgcccgtttcagagatattagtgatatttcatttatacaatctaagaag
gtggtttgcttcaaagaaccctcttccacgggtgtatctaatggtgatttgcttcacaga
cagccattcacagaggaaagcccaagcagcaggtgcatacagaaggatattggcacacag
acgaatttgaaatgccggagaggcattgaaaattgggagtttattagttcaactacagtt
agaagtcctctacaggaagcagagagcaaagtcagtatggcattagaagaaactcttagg
caatatcaagcagccaaatctgtaatgaggtctgaacctgaagggtgtagtggaaccatt
gggaataaaattattatccctatgatgactgtcataaaaagtgattcaagtagtgatgcc
agtgatggaaatggttcctgctcgtgggacagtaatttaccagagtctttggaatcagtt
tctgatgttcttctaaacttctttccatatgtttcacccaagacaagtataacagatagc
agggaggaagagggtgtgtcagagagtgaggatggtggtggtagcagtgtagattcactg
gctgcacatgtgaaaaaccttctgcaatgtgaatcctcactgaatcatgctaaagaaata
ctcagaaatgcagaggaagaggaaagccgggtacgagcacatgcctggaatatgaagttc
aatttagcacatgattgtggatactccatttcagaattaaatgaagatgacaggaggaaa
gtagaagagatcaaggcagagttatttggtcatggaagaacaactgacttgtccaagggt
ttacagagtccacggggaatgggatgcaagccagaagctgtatgtagtcacattattatt
gagagccatgaaaagggatgtttccggactctaacttctgaacatccacaactagataga
cacccttgtgctttcagatctgctggaccctcagaaatgaccagaggacggcagaaccca
tcatcatgcagagccaagcatgtcaacctttctgcatccttagaccagaacaactcccat
ttcaaagtttggaattccttgcagttaaaaagtcattccccatttcagaactttatacct
gatgaattcaaaatcagcaaaggtcttcgaatgccattcgatgaaaagatggacccttgg
ctgtcagaattagtagaacctgcttttgtgccacctaaagaagtggattttcattcttca
tcacaaatgccgtccccagaacccatgaaaaagtttactacctccatcactttttcatct
caccgacattctaaatgcatttccaattcctctgttgttaaggttggtgttactgaaggt
agccagtgtactggagcatctgtgggggtatttaattctcatttcactgaagaacaaaat
cctcccagagatcttaaacagaaaacctcttccccttcatcatttaaaatgcatagtaat
tcacaagataaagaagtgactattttagcagaaggtagaaggcaaagccaaaaattacct
gttgattttgagcgttcttttcaagaagaaaaacccttagaaagatcagattttacaggc
agtcattctgagcccagtaccagggcaaattgtagcaatttcaaggaaattcagatttct
gataaccatacccttattagcatgggcagaccaagttccaccctaggagtaaacagatcg
agttccagactaggagtaaaagagaagaatgtaactataactccagatcttccttcttgc
atttttcttgaacaacgagagctctttgaacaaagcaaagccccacgtgcagatgaccat
gtgaggaaacaccattctccctctcctcaacatcaggattatgtagctccagaccttcct
tcttgcatttttcttgaacaacgagaactctttgaacagtgcaaagccccatatgtagat
catcaaatgagagaaaaccattctccccttcctcaaggtcaggattctatagcttcagac
cttccgtctcccatttctcttgaacaatgccaaagcaaagcgccaggtgtagatgaccaa
atgaataaacaccattttccccttcctcaaggtcaggattgtgtagtggaaaagaataat
caacataagcctaaatcacacatttctaatataaatgttgaagccaagttcaatactgtg
gtctcccagtcagccccaaatcactgtacattagcagcatctgcatctactcctccttca
aatagaaaagcactttcttgtgttcatataactctttgtcccaagacttcttccaagttg
gatagtggaactttagatgaaagattccattcattggatgctgcttctaaagcgaggatg
aatagtgagtttaactttgacttacatactgtatcttcgagatcactggaaccaacctcc
aaattattgaccagtaaacctgtagcacaggatcaagaatctttaggttttctaggacct
aaatcttcactggatttccaagtcgtacagccttctcttccagacagtaacactattact
caggacttgaaaaccataccttctcagaatagccagatagtaacctccaggcaaatacaa
gtgaacatttcagatttcgaaggacattccaatccagaggggaccccagtatttgcagat
cgattaccagagaagatgaagaccccactttctgctttctctgaaaaattgtcatctgat
gcagtcactcagataacaacagaaagtccagaaaagaccctattttcatctgagattttt
attaatgctgaagatcgtggacatgaaattatagagcctggtaaccagaagctacgcaaa
gctcctgtcaagtttgcctcatcatcttcagtccaacaggttactttttctcgcggcaca
gatggccagcctttattattgccatataagccttctggtagtaccaagatgtattatgtt
ccacaattaagacaaattcctccatctccggattccaaatcagataccaccgttgaaagc
tcccattcaggatccaatgatgccattgctccagacttcccagctcaggtgctaggcaca
agagatgatgacctctcagccactgttaacattaaacataaagaaggaatctacagtaag
agggtagtgactaaggcatccttgccagtgggagaaaaacccttgcagaatgaaaatgca
gatgcctcagttcaagtgctaatcactggggatgagaacctctcagacaaaaaacagcaa
gagattcacagtacaagggcagtgactgaggctgcccaggctaaagaaaaagaatctttg
cagaaagatactgcagattccagtgctgctgctgctgcagagcactcagctcaagtagga
gacccagaaatgaagaacttgccagacactaaagccattacacagaaagaggagatccat
aggaagaagacagttcccgaggaagcctggccaaacaataaagaatccctacagatcaat
attgaagagtccgaatgtcattcagaatttgaaaatactacccgttctgtcttcaggtca
gcaaagttttacattcatcatcccgtacacctaccaagtgatcaagatatttgccatgaa
tctttgggaaagagtgttttcatgagacattcttggaaagatttctttcagcatcatcca
gacaaacatagagaacacatgtgtcttcctcttccttatcaaaacatggacaagactaag
acagattataccagaataaagagcctcagcatcaatgtgaatttgggaaacaaagaagtg
atggatactactaaaagtcaagttagagattatccaaaacataatggacaaattagtgat
ccacaaagggatcagaaggtcaccccagagcaaacaactcagcacactgtgagtttgaat
gaactgtggaacaagtatcgggagcgacagaggcaacagagacagcctgagttgggtgac
aggaaagaactgtccttggtggaccgacttgatcgtttggctaaaattcttcagaatcca
atcacacattctctccaggtctcagaaagtacacatgatgatagcagaggggaacgaagt
gtgaaggaatggagtggtagacaacagcagagaaataagcttcagaaaaagaagcggttt
aaaagcctagagaaaagccataaaaatacaggcgagcttaaaaaaagcaaggtgctttct
catcatcgagctgggaggtctaatcaaattaaaattgaacagattaaatttgataaatat
attctgagtaaacagccaggttttaattatataagcaacacttcttcggattgtcggccc
tcagaggagagtgagctgctcacagatactaccaccaacatcctttccggcaccacttct
actgtcgaatcagatatattgacccaaacagatagagaggtggctctgcacgaaaggagt
agctctgtttccactattgacactgcccggctgattcaagcttttggccatgaaagagta
tgcttgtcacccagacgaattaaattatatagcagcatcaccaaccaacagaggagatac
cttgagaagcggagcaaacacagcaagaaagtgctgaatacaggtcatcccctagtgact
tctgagcacaccagaaggagacacatccaggtagcaaaccatgtgatttcttctgactct
atttcctcttctgccagtagtttcctgagctcaaactctactttttgcaacaagcagaat
gtacacatgttaaacaagggcatacaagcaggtaacttggagattgtgaacggtgccaaa
aaacacactcgagatgttgggataactttcccaactccaagttccagcgaggctaaattg
gaagagaacagtgatgtgacttcttggtcagaagaaaaacgtgaagagaaaatgctcttt
accggttatcctgaggacagaaagttaaaaaagaacaagaagaattcccatgaaggagtt
tcctggtttgttcctgtggaaaatgtggagtctagatcaaagaaggaaaacgtgcctaac
acttgtggccctggcatctcctggtttgaaccaataaccaagaccagaccctggagggag
ccactgcgggagcagaactgtcaggggcagcacctggacggtcggggctacctggcaggc
ccaggcagagaggctggcagagacctactgaggccatttgtgagagcaacccttcaggaa
tcgcttcagtttcacagacctgacttcatctcccgctctggggagcggataaagcgcctg
aagttaatagtccaggagaggaagctgcagagcatgttacagaccgagcgggatgcacta
ttcaacattgacagggaacggcagggccaccagaatcgcatgtgcccgctgcccaagaga
gtcttcctggctatccagaagaacaagcctatcagcaagaaggaaatgattcagaggtcc
aaacggatttatgagcagcttccagaagtacagaaaaagagagaagaagagaagagaaaa
tcagaatataagtcataccggctgcgagcccagctatataaaaagagagtgaccaatcaa
cttctggggagaaaagttccctgggactga

DBGET integrated database retrieval system