KEGG   Homo sapiens (human): 7849Help
Entry
7849              CDS       T01001                                 

Gene name
PAX8
Definition
paired box 8
Orthology
K09293  
paired box protein 8
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone synthesis
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Disease
H00032  
Thyroid cancer
H00250  
Congenital nongoitrous hypothyroidism (CHNG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    7849 (PAX8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7849 (PAX8)
   05202 Transcriptional misregulation in cancers
    7849 (PAX8)
   05216 Thyroid cancer
    7849 (PAX8)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    7849 (PAX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q13
AA seq 450 aa AA seqDB search
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaactccatcagatctggccatggagggctgaaccagctgggaggggccttt
gtgaatggcagacctctgccggaagtggtccgccagcgcatcgtagacctggcccaccag
ggtgtaaggccctgcgacatctctcgccagctccgcgtcagccatggctgcgtcagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagattggggactacaaacgccagaaccct
accatgtttgcctgggagatccgagaccggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccattaatagaatcatccggaccaaagtgcagcaaccattc
aacctccctatggacagctgcgtggccaccaagtccctgagtcccggacacacgctgatc
cccagctcagctgtaactcccccggagtcaccccagtcggattccctgggctccacctac
tccatcaatgggctcctgggcatcgctcagcctggcagcgacaagaggaaaatggatgac
agtgatcaggatagctgccgactaagcattgactcacagagcagcagcagcggaccccga
aagcaccttcgcacggatgccttcagccagcaccacctcgagccgctcgagtgcccattt
gagcggcagcactacccagaggcctatgcctcccccagccacaccaaaggcgagcagggc
ctctacccgctgcccttgctcaacagcaccctggacgacgggaaggccaccctgacccct
tccaacacgccactggggcgcaacctctcgactcaccagacctaccccgtggtggcagat
cctcactcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctccacc
ccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtcccg
cccttcaatgcctttccccatgctgcctccgtgtacgggcagttcacgggccaggccctc
ctctcagggcgagagatggtggggcccacgctgcccggatacccaccccacatccccacc
agcggacagggcagctatgcctcctctgccatcgcaggcatggtggcaggaagtgaatac
tctggcaatgcctatggccacaccccctactcctcctacagcgaggcctggcgcttcccc
aactccagcttgctgagttccccatattattacagttccacatcaaggccgagtgcaccg
cccaccactgccacggcctttgaccatctgtag

DBGET integrated database retrieval system