KEGG   Homo sapiens (human): 7849Help
Entry
7849              CDS       T01001                                 

Gene name
PAX8
Definition
paired box 8
Orthology
K09293  
paired box protein 8
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone synthesis
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Disease
H00032  
Thyroid cancer
H00250  
Congenital nongoitrous hypothyroidism (CHNG)
Class
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q13
AA seq 450 aa AA seqDB search
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaactccatcagatctggccatggagggctgaaccagctgggaggggccttt
gtgaatggcagacctctgccggaagtggtccgccagcgcatcgtagacctggcccaccag
ggtgtaaggccctgcgacatctctcgccagctccgcgtcagccatggctgcgtcagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagattggggactacaaacgccagaaccct
accatgtttgcctgggagatccgagaccggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccattaatagaatcatccggaccaaagtgcagcaaccattc
aacctccctatggacagctgcgtggccaccaagtccctgagtcccggacacacgctgatc
cccagctcagctgtaactcccccggagtcaccccagtcggattccctgggctccacctac
tccatcaatgggctcctgggcatcgctcagcctggcagcgacaagaggaaaatggatgac
agtgatcaggatagctgccgactaagcattgactcacagagcagcagcagcggaccccga
aagcaccttcgcacggatgccttcagccagcaccacctcgagccgctcgagtgcccattt
gagcggcagcactacccagaggcctatgcctcccccagccacaccaaaggcgagcagggc
ctctacccgctgcccttgctcaacagcaccctggacgacgggaaggccaccctgacccct
tccaacacgccactggggcgcaacctctcgactcaccagacctaccccgtggtggcagat
cctcactcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctccacc
ccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtcccg
cccttcaatgcctttccccatgctgcctccgtgtacgggcagttcacgggccaggccctc
ctctcagggcgagagatggtggggcccacgctgcccggatacccaccccacatccccacc
agcggacagggcagctatgcctcctctgccatcgcaggcatggtggcaggaagtgaatac
tctggcaatgcctatggccacaccccctactcctcctacagcgaggcctggcgcttcccc
aactccagcttgctgagttccccatattattacagttccacatcaaggccgagtgcaccg
cccaccactgccacggcctttgaccatctgtag

DBGET integrated database retrieval system