KEGG   Homo sapiens (human): 785Help
Entry
785               CDS       T01001                                 

Gene name
CACNB4, CAB4, CACNLB4, EA5, EIG9, EJM, EJM4, EJM6
Definition
calcium channel, voltage-dependent, beta 4 subunit
Orthology
K04865  
voltage-dependent calcium channel beta-4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00749  
Episodic ataxias
H00808  
Idiopathic generalized epilepsies (IGEs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    785 (CACNB4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    785 (CACNB4)
  Circulatory system
   04260 Cardiac muscle contraction
    785 (CACNB4)
   04261 Adrenergic signaling in cardiomyocytes
    785 (CACNB4)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    785 (CACNB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    785 (CACNB4)
   05414 Dilated cardiomyopathy (DCM)
    785 (CACNB4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN beta
   785 (CACNB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q22-q23
AA seq 520 aa AA seqDB search
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPS
DSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISF
DAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNS
SSSLGEMVSGTFRATPTSTAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQK
ALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIF
ELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQ
LVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQH
SRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctcctcctacgccaagaacgggaccgcggacgggccgcactcccccacctcg
caggtggcccgaggcaccacaacccggaggagcaggttgaaaagatccgatggcagcacc
acttcgaccagcttcatcctcagacagggttcagcggattcctacacaagcaggccgtct
gactccgatgtctctttggaagaggaccgggaagcaattcgacaggagagagaacagcaa
gcagctatccagcttgagagagcaaagtccaaacctgtagcatttgccgtgaagacaaat
gtgagctactgcggcgccctggacgaggatgtgcctgttccaagcacagctatctccttt
gatgctaaagactttctacatattaaagagaaatataacaatgattggtggataggaagg
ctggtgaaagagggctgtgaaattggcttcattccaagtccactcagattggagaacata
cggatccagcaagaacaaaaaagaggacgttttcacggagggaaatcaagtggaaattct
tcttcaagtcttggagaaatggtatctgggacattccgagcaactcccacatcaacagca
aaacagaagcaaaaagtgacggagcacattcctccttacgatgttgtaccgtcaatgcgt
ccggtggtgttagtggggccgtcactgaaaggttacgaggtaacagacatgatgcagaaa
gccctctttgatttcctgaagcacaggtttgatgggaggatttcaataacgagagtgaca
gctgacatttctcttgctaagaggtctgtcctaaataatcccagcaagagagcaataatt
gaacgttcgaacacccggtccagcttagcggaagtacaaagtgaaattgaaagaatcttt
gagttggcaagatctttgcaactggttgttcttgatgcagacaccatcaatcacccagca
caacttataaagacttccttagcaccaattattgttcatgtaaaagtctcatctccaaag
gttttacagcggttgattaaatctagaggaaagtcacaaagtaaacacttgaatgttcaa
ctggtggcagctgataaacttgcacaatgccccccagaaatgtttgatgttatattggat
gaaaatcagcttgaggatgcatgtgaacatctaggggagtacctggaggcgtactggcgt
gccacccacacaaccagtagcacacccatgaccccgctgctgggaaggaatttgggctcc
acggcactctcaccatatcccacagcaatttctgggttacagagtcagcgaatgaggcac
agcaaccactccacagagaactctccaattgaaagacgaagtctaatgacctctgatgaa
aattatcacaatgaaagggctcggaagagtaggaaccgcttgtcttccagttctcagcat
agccgagatcattaccctcttgtggaagaagattaccctgactcataccaggacacttac
aaaccccataggaaccgaggatcacctgggggatatagccatgactcccgacataggctt
tga

DBGET integrated database retrieval system