KEGG   Homo sapiens (human): 79009Help
Entry
79009             CDS       T01001                                 

Gene name
DDX50, GU2, GUB, RH-II/GuB, mcdrh
Definition
(RefSeq) DEAD-box helicase 50 (EC:3.6.4.13)
  KO
K13183  
ATP-dependent RNA helicase DDX50 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     79009 (DDX50)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    79009 (DDX50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.1
AA seq 737 aa AA seqDB search
MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPK
AKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHK
SSDNKLEETLTREQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQ
ARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSV
ACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGF
AEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAAT
TVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHG
DIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTG
RAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYA
AVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPRSLITSDKGFVTMTLESLEEIQD
VSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPAK
LPEIEEYYDGNTSSNSRQRSGWSSGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRR
SGNRNRSRSGGHKRSFD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaaactcctctggggggacattatggagctggaagcacccttggaggagtcc
gagagccagaagaaggagaggcaaaagagtgacagaaggaagtcaaggcaccattatgac
tcggatgagaaatcagaaacaagagaaaatggtgttacagatgacctggatgctcccaag
gccaaaaaatctaaaatgaaagagaagctaaatggagacactgaagaaggatttaataga
ctttcagatgaattctccaaatctcataagtcaagaagaaaagatctaccaaatggagat
atagatgaatatgaaaaaaaatcaaagcgagtatcatctttagatacttctactcataaa
tcaagtgataataaactagaggagaccttaacacgtgaacagaaagaaggagccttctcc
aattttcctatttctgaagagactataaagcttctgaaaggtcgaggggtaacatatctc
tttcctattcaagttaagacctttggtcctgtatatgaaggaaaagatttaatagctcaa
gcacggacaggaacaggaaagacattctcttttgccatccccttaattgaaagactccaa
agaaatcaagaaacaattaaaaaaagccgctcaccaaaggtacttgttttggctccaaca
agggaactggcaaaccaagtagccaaagacttcaaagatataactaggaaactcagcgtg
gcgtgtttttatggtggaacatcatatcaaagccaaattaatcatattcgaaatggtatt
gacatcttggttggaacacctggtcgtatcaaagaccatctgcagagtggccgattggat
ctttctaaactgcgacatgttgtgcttgatgaagtggatcagatgttagatttaggtttc
gctgaacaagttgaagatattattcatgaatcctacaaaactgattctgaagacaatcct
cagactttacttttttctgcaacttgcccacagtgggtatacaaagttgcaaaaaaatac
atgaaatccagatatgaacaggttgaccttgttggaaaaatgactcaaaaggctgcaact
actgtggaacatttggccatccagtgtcattggtctcagaggccagcagttattggagat
gtccttcaagtctacagtgggtctgaagggagggctattattttctgtgagaccaagaag
aatgtaactgaaatggccatgaatccacacataaaacagaatgcccagtgtttacatggg
gacattgcacagtcacaaagagaaattacactaaaaggcttcagagaaggtagttttaaa
gttttggtggcaaccaatgtggctgcccgtggtttggacattcctgaagttgacctggtg
attcaaagttctcctcctcaggatgttgagtcctatatccatcgctctggacgcacaggt
agagctggacggacagggatttgtatatgtttttatcaaccaagagaaagaggtcaacta
agatatgtggaacaaaaagcaggaattacttttaaacgtgtaggtgttccttctacaatg
gatttagttaaatctaaaagcatggatgccatcaggtctctggcttccgtttcttatgct
gctgttgattttttccgaccatcagctcagagactgatagaagagaaaggtgcagtggat
gcattggctgcagctttagcccacatttctggtgcatcaagctttgaaccacgatctttg
atcacctctgataaggggtttgtgaccatgactctggaaagcctagaggaaatacaggat
gtcagctgtgcttggaaagaacttaacagaaagctgagtagtaatgcagtgtctcagatt
accagaatgtgcctcctgaaaggaaatatgggtgtttgctttgatgttcctacaactgag
tcagaaaggttacaggcagagtggcatgattccgactggatactctcagtgccagccaaa
ttacctgaaattgaagaatattatgatggaaacacatcttctaattccagacagaggagt
ggctggtcaagtggtcgatcaggccggtcaggccggtcaggtggtcgatctggcggccgg
tcaggtagacagagtcgacaaggaagtcgctcaggaagtcgacaagatggtagaagacga
agtgggaatagaaatcgatcaagaagtgggggccacaaacggagttttgactga

DBGET integrated database retrieval system