KEGG   Homo sapiens (human): 7903Help
Entry
7903              CDS       T01001                                 

Gene name
ST8SIA4, PST, PST1, SIAT8D, ST8SIA-IV
Definition
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 (EC:2.4.99.-)
Orthology
K06614  
alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8D) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q21
AA seq 359 aa AA seqDB search
MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAG
SSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNI
SHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIRCNLAPVVEFAAD
VGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWV
NALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALKLTTGKCVKQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccattaggaagaggtggacgatctgcacaataagtctgctcctgatcttttat
aagacaaaagaaatagcaagaactgaggagcaccaggagacgcaactcatcggagatggt
gaattgtctttgagtcggtcacttgtcaatagctctgataaaatcattcgaaaggctggc
tcttcaatcttccagcacaatgtagaaggttggaaaatcaattcctctttggtcctagag
ataaggaagaacatacttcgtttcttagatgcagaacgagatgtgtcagtggtcaagagc
agttttaagcctggtgatgtcatacactatgtgcttgacaggcgccggacactaaacatt
tctcatgatctacatagcctcctacctgaagtttcaccaatgaagaatcgcaggtttaag
acctgtgcagttgttggaaattctggcattctgttagacagtgaatgtggaaaggagatt
gacagtcacaattttgtaataaggtgtaatctagctcctgtggtggagtttgctgcagat
gtgggaactaaatcagattttattaccatgaatccatcagttgtacaaagagcatttgga
ggctttcgaaatgagagtgacagagaaaaatttgtgcatagactttccatgctgaatgac
agtgtcctttggattcctgctttcatggtcaaaggaggagagaagcacgtggagtgggtt
aatgcattaatccttaagaataaactgaaagtgcgaactgcctatccgtcattgagactt
attcatgctgtcagaggttactggctgaccaacaaagttcctatcaaaagacccagcaca
ggtcttctcatgtatacacttgccacaagattctgtgatgaaattcacctgtatggattc
tggcccttccctaaggatttaaatggaaaagcggtcaaatatcattattatgatgactta
aaatataggtacttttccaatgcaagccctcacagaatgccattagaattcaaaacatta
aatgtgctacataatagaggagctctaaaactgacaacaggaaagtgtgtaaagcaataa

DBGET integrated database retrieval system