KEGG   Homo sapiens (human): 79092Help
Entry
79092             CDS       T01001                                 

Gene name
CARD14, BIMP2, CARMA2, PRP, PSORS2, PSS1
Definition
caspase recruitment domain family, member 14
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25
AA seq 740 aa AA seqDB search
MGELCRRDSALTALDEETLWEMMESHRHRIVRCICPSRLTPYLRQAKVLCQLDEEEVLHS
PRLTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLME
TSKLTECLAGAIGSLQEELNQEKGQKEVLLRRCQQLQEHLGLAETRAEGLHQLEADHSRM
KREVSAHFHEVLRLKDEMLSLSLHYSNALQEKELAASRCRSLQEELYLLKQELQRANMVS
SCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILEQSLDEARGSRQE
LVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKE
RDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQEART
REPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPAPPS
QQSLYKRVAEDFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLESSL
QPVSPGRLDVSESGVLMRRRPARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHRVTP
GSAADQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEEAVGLLRRVDGFCCLSVKVNTDG
YKRLLQDLEAKVATSGDSFYIRVNLAMEGRAKGELQVHCNEVLHVTDTMFQGCGCWHAHR
VNSYTMKDTAAHGTIPNYSR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgggggaactgtgccgcagggactccgcactcacggcactggacgaggagacactgtgg
gagatgatggagagccaccgccacaggatcgtacgctgcatctgccccagccgcctcacc
ccctacctgcgccaggccaaggtgctgtgccagctggacgaggaggaggtgctgcacagc
ccccggctcaccaacagcgccatgcgggccgggcacttgctggatttgctgaagactcga
gggaagaacggggccatcgccttcctggagagcctgaagttccacaaccctgacgtctac
accctggtcaccgggctgcagcctgatgttgacttcagtaactttagcggtctcatggag
acatccaagctgaccgagtgcctggctggggccatcggcagcctgcaggaggagctgaac
caggaaaaggggcagaaggaggtgctgctgcggcggtgccagcagctgcaggagcacctg
ggcctggccgagacccgtgccgagggcctgcaccagctggaggctgaccacagccgcatg
aagcgtgaggttagcgcacacttccatgaggtgctgaggctgaaggacgagatgctcagc
ctctcgctgcactatagcaatgcgctgcaggagaaggagctggccgcctcacgctgccgc
agcctgcaggaggagctgtatctactgaagcaggagctgcagcgagccaacatggtttcc
tcctgtgagctggaattgcaagagcagtccctgaggacagccagcgaccaggagtccggg
gatgaggagctgaaccgcctgaaggaggagaatgagaaactgcgctcgctgactttcagc
ctggcggagaaggacattctggagcagagcctggacgaggcgcgggggagccgacaggag
ctggtggagcgcatccactcgctgcgggagcgggccgtggctgccgagaggcagcgagag
cagtactgggaagagaaggaacagaccctgctgcagttccagaagagtaagatggcctgc
caactctacagggagaaggtgaatgcgctgcaggcccaggtgtgcgagctgcagaaggag
cgagaccaggcgtactccgcgagggacagtgctcagagggagatttcccagagcctggtg
gagaaggactccctccgcaggcaggtgttcgagctgacggaccaggtctgcgagctgcgc
acacagcttcgccagctgcaggcagagcctccgggtgtgctcaagcaggaagccaggacc
agggagccctgtccacgggagaagcagcggctggtgcggatgcatgccatctgccccaga
gacgacagcgactgcagcctcgtcagctccacagagtctcagctcttgtcggacctgagt
gccacgtccagccgcgagctggtggacagcttccgctccagcagccccgcgccccccagc
cagcagtccctgtacaagcgggtggccgaggacttcggggaagaaccctggtctttcagc
agctgcctggagatcccggagggagacccgggagccctgccgggagctaaggcaggcgac
ccacacctggattatgagctcctagacacggcagaccttccgcagctggaaagcagcctg
cagccagtctcccctggaaggcttgatgtctcggagagcggcgtcctcatgcggcggagg
ccagcccgcaggatcctgagccaggtcaccatgctggcgttccagggggatgcattgctg
gagcagatcagcgtcatcggcgggaacctcacgggcatcttcatccaccgggtcaccccg
ggctcggcggcggaccagatggccttgcgcccgggcacccagattgtgatggttgattac
gaagcctcagagcccttgttcaaggcagtcctggaggacacgaccctggaggaggccgtg
gggcttctcaggagggtggacggcttctgctgcctgtctgtgaaggtcaacacggacggt
tataagaggctactccaggacctggaggccaaagtggcgacctcgggggactcattctac
atccgggtcaacctggccatggagggcagggccaaaggggagctgcaggtgcattgcaac
gaggtcctgcacgtcaccgacaccatgttccagggctgcggctgctggcatgcccaccgc
gtgaactcttacaccatgaaggatactgccgcgcacggcaccatccccaactactccagg
tga

DBGET integrated database retrieval system