KEGG   Homo sapiens (human): 79092Help
Entry
79092             CDS       T01001                                 

Gene name
CARD14, BIMP2, CARMA2, PRP, PSORS2, PSS1
Definition
caspase recruitment domain family, member 14
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25
AA seq 740 aa AA seqDB search
MGELCRRDSALTALDEETLWEMMESHRHRIVRCICPSRLTPYLRQAKVLCQLDEEEVLHS
PRLTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLME
TSKLTECLAGAIGSLQEELNQEKGQKEVLLRRCQQLQEHLGLAETRAEGLHQLEADHSRM
KREVSAHFHEVLRLKDEMLSLSLHYSNALQEKELAASRCRSLQEELYLLKQELQRANMVS
SCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILEQSLDEARGSRQE
LVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKE
RDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQEART
REPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPAPPS
QQSLYKRVAEDFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLESSL
QPVSPGRLDVSESGVLMRRRPARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHRVTP
GSAADQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEEAVGLLRRVDGFCCLSVKVNTDG
YKRLLQDLEAKVATSGDSFYIRVNLAMEGRAKGELQVHCNEVLHVTDTMFQGCGCWHAHR
VNSYTMKDTAAHGTIPNYSR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgggggaactgtgccgcagggactccgcactcacggcactggacgaggagacactgtgg
gagatgatggagagccaccgccacaggatcgtacgctgcatctgccccagccgcctcacc
ccctacctgcgccaggccaaggtgctgtgccagctggacgaggaggaggtgctgcacagc
ccccggctcaccaacagcgccatgcgggccgggcacttgctggatttgctgaagactcga
gggaagaacggggccatcgccttcctggagagcctgaagttccacaaccctgacgtctac
accctggtcaccgggctgcagcctgatgttgacttcagtaactttagcggtctcatggag
acatccaagctgaccgagtgcctggctggggccatcggcagcctgcaggaggagctgaac
caggaaaaggggcagaaggaggtgctgctgcggcggtgccagcagctgcaggagcacctg
ggcctggccgagacccgtgccgagggcctgcaccagctggaggctgaccacagccgcatg
aagcgtgaggttagcgcacacttccatgaggtgctgaggctgaaggacgagatgctcagc
ctctcgctgcactatagcaatgcgctgcaggagaaggagctggccgcctcacgctgccgc
agcctgcaggaggagctgtatctactgaagcaggagctgcagcgagccaacatggtttcc
tcctgtgagctggaattgcaagagcagtccctgaggacagccagcgaccaggagtccggg
gatgaggagctgaaccgcctgaaggaggagaatgagaaactgcgctcgctgactttcagc
ctggcggagaaggacattctggagcagagcctggacgaggcgcgggggagccgacaggag
ctggtggagcgcatccactcgctgcgggagcgggccgtggctgccgagaggcagcgagag
cagtactgggaagagaaggaacagaccctgctgcagttccagaagagtaagatggcctgc
caactctacagggagaaggtgaatgcgctgcaggcccaggtgtgcgagctgcagaaggag
cgagaccaggcgtactccgcgagggacagtgctcagagggagatttcccagagcctggtg
gagaaggactccctccgcaggcaggtgttcgagctgacggaccaggtctgcgagctgcgc
acacagcttcgccagctgcaggcagagcctccgggtgtgctcaagcaggaagccaggacc
agggagccctgtccacgggagaagcagcggctggtgcggatgcatgccatctgccccaga
gacgacagcgactgcagcctcgtcagctccacagagtctcagctcttgtcggacctgagt
gccacgtccagccgcgagctggtggacagcttccgctccagcagccccgcgccccccagc
cagcagtccctgtacaagcgggtggccgaggacttcggggaagaaccctggtctttcagc
agctgcctggagatcccggagggagacccgggagccctgccgggagctaaggcaggcgac
ccacacctggattatgagctcctagacacggcagaccttccgcagctggaaagcagcctg
cagccagtctcccctggaaggcttgatgtctcggagagcggcgtcctcatgcggcggagg
ccagcccgcaggatcctgagccaggtcaccatgctggcgttccagggggatgcattgctg
gagcagatcagcgtcatcggcgggaacctcacgggcatcttcatccaccgggtcaccccg
ggctcggcggcggaccagatggccttgcgcccgggcacccagattgtgatggttgattac
gaagcctcagagcccttgttcaaggcagtcctggaggacacgaccctggaggaggccgtg
gggcttctcaggagggtggacggcttctgctgcctgtctgtgaaggtcaacacggacggt
tataagaggctactccaggacctggaggccaaagtggcgacctcgggggactcattctac
atccgggtcaacctggccatggagggcagggccaaaggggagctgcaggtgcattgcaac
gaggtcctgcacgtcaccgacaccatgttccagggctgcggctgctggcatgcccaccgc
gtgaactcttacaccatgaaggatactgccgcgcacggcaccatccccaactactccagg
tga

DBGET integrated database retrieval system