KEGG   Homo sapiens (human): 79092Help
Entry
79092             CDS       T01001                                 

Gene name
CARD14, BIMP2, CARMA2, PRP, PSORS2, PSS1
Definition
(RefSeq) caspase recruitment domain family member 14
  KO
K20913  
caspase recruitment domain-containing protein 14
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Disease
H01659  
Pityriasis rubra pilaris
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    79092 (CARD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25
AA seq 1004 aa AA seqDB search
MGELCRRDSALTALDEETLWEMMESHRHRIVRCICPSRLTPYLRQAKVLCQLDEEEVLHS
PRLTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLME
TSKLTECLAGAIGSLQEELNQEKGQKEVLLRRCQQLQEHLGLAETRAEGLHQLEADHSRM
KREVSAHFHEVLRLKDEMLSLSLHYSNALQEKELAASRCRSLQEELYLLKQELQRANMVS
SCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILEQSLDEARGSRQE
LVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKE
RDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQEART
REPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPAPPS
QQSLYKRVAEDFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLESSL
QPVSPGRLDVSESGVLMRRRPARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHRVTP
GSAADQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEEAVGLLRRVDGFCCLSVKVNTDG
YKRLLQDLEAKVATSGDSFYIRVNLAMEGRAKGELQVHCNEVLHVTDTMFQGCGCWHAHR
VNSYTMKDTAAHGTIPNYSRAQQQLIALIQDMTQQCTVTRKPSSGGPQKLVRIVSMDKAK
ASPLRLSFDRGQLDPSRMEGSSTCFWAESCLTLVPYTLVRPHRPARPRPVLLVPRAVGKI
LSEKLCLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTH
ALLDVQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDL
DRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgggggaactgtgccgcagggactccgcactcacggcactggacgaggagacactgtgg
gagatgatggagagccaccgccacaggatcgtacgctgcatctgccccagccgcctcacc
ccctacctgcgccaggccaaggtgctgtgccagctggacgaggaggaggtgctgcacagc
ccccggctcaccaacagcgccatgcgggccgggcacttgctggatttgctgaagactcga
gggaagaacggggccatcgccttcctggagagcctgaagttccacaaccctgacgtctac
accctggtcaccgggctgcagcctgatgttgacttcagtaactttagcggtctcatggag
acatccaagctgaccgagtgcctggctggggccatcggcagcctgcaggaggagctgaac
caggaaaaggggcagaaggaggtgctgctgcggcggtgccagcagctgcaggagcacctg
ggcctggccgagacccgtgccgagggcctgcaccagctggaggctgaccacagccgcatg
aagcgtgaggttagcgcacacttccatgaggtgctgaggctgaaggacgagatgctcagc
ctctcgctgcactatagcaatgcgctgcaggagaaggagctggccgcctcacgctgccgc
agcctgcaggaggagctgtatctactgaagcaggagctgcagcgagccaacatggtttcc
tcctgtgagctggaattgcaagagcagtccctgaggacagccagcgaccaggagtccggg
gatgaggagctgaaccgcctgaaggaggagaatgagaaactgcgctcgctgactttcagc
ctggcggagaaggacattctggagcagagcctggacgaggcgcgggggagccgacaggag
ctggtggagcgcatccactcgctgcgggagcgggccgtggctgccgagaggcagcgagag
cagtactgggaagagaaggaacagaccctgctgcagttccagaagagtaagatggcctgc
caactctacagggagaaggtgaatgcgctgcaggcccaggtgtgcgagctgcagaaggag
cgagaccaggcgtactccgcgagggacagtgctcagagggagatttcccagagcctggtg
gagaaggactccctccgcaggcaggtgttcgagctgacggaccaggtctgcgagctgcgc
acacagcttcgccagctgcaggcagagcctccgggtgtgctcaagcaggaagccaggacc
agggagccctgtccacgggagaagcagcggctggtgcggatgcatgccatctgccccaga
gacgacagcgactgcagcctcgtcagctccacagagtctcagctcttgtcggacctgagt
gccacgtccagccgcgagctggtggacagcttccgctccagcagccccgcgccccccagc
cagcagtccctgtacaagcgggtggccgaggacttcggggaagaaccctggtctttcagc
agctgcctggagatcccggagggagacccgggagccctgccgggagctaaggcaggcgac
ccacacctggattatgagctcctagacacggcagaccttccgcagctggaaagcagcctg
cagccagtctcccctggaaggcttgatgtctcggagagcggcgtcctcatgcggcggagg
ccagcccgcaggatcctgagccaggtcaccatgctggcgttccagggggatgcattgctg
gagcagatcagcgtcatcggcgggaacctcacgggcatcttcatccaccgggtcaccccg
ggctcggcggcggaccagatggccttgcgcccgggcacccagattgtgatggttgattac
gaagcctcagagcccttgttcaaggcagtcctggaggacacgaccctggaggaggccgtg
gggcttctcaggagggtggacggcttctgctgcctgtctgtgaaggtcaacacggacggt
tataagaggctactccaggacctggaggccaaagtggcgacctcgggggactcattctac
atccgggtcaacctggccatggagggcagggccaaaggggagctgcaggtgcattgcaac
gaggtcctgcacgtcaccgacaccatgttccagggctgcggctgctggcatgcccaccgc
gtgaactcttacaccatgaaggatactgccgcgcacggcaccatccccaactactccagg
gctcagcagcagctcatagccctcatccaggacatgactcagcagtgcaccgtgacccgc
aagccatcttctgggggaccacagaagctggtccgcatcgtcagtatggacaaagccaag
gccagccctctgcgtttgtcctttgacaggggccagttggaccccagcaggatggagggc
tccagcacgtgcttctgggccgagagctgcctcaccctggtgccctataccctggtgcgg
ccccatcgacccgcccggccccggcctgtgctcctcgtgcccagggcggttgggaagatc
ctgagcgagaaactgtgcctcctccaagggtttaagaagtgcctggcagagtacttgagc
caggaggagtatgaggcctggagccagagaggggacatcatccaggagggagaggtgtcc
gggggccgctgctgggtgacccgccatgctgtggagtccctcatggaaaagaacacccat
gccctcctggacgtccagctggacagtgtctgcaccctgcacaggatggacatcttcccc
atcgtcatccacgtctctgtcaacgagaagatggcaaagaagctcaagaagggcctacag
cggttgggcacctcagaggagcagctcctggaggctgcgaggcaggaggagggagacctg
gaccgggcgccctgtctatacagcagcctggctcctgacggctggagcgacctggacggc
ctgctcagctgtgtccgccaggccatcgccgacgagcagaagaaggtggtgtggacggag
cagagcccccgatga

DBGET integrated database retrieval system