KEGG   Homo sapiens (human): 79152Help
Entry
79152             CDS       T01001                                 

Gene name
FA2H, FAAH, FAH1, FAXDC1, SCS7, SPG35
Definition
fatty acid 2-hydroxylase
Organism
hsa  Homo sapiens (human)
Disease
H00833  
Neurodegeneration with brain iron accumulation (NBIA)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q23
AA seq 372 aa AA seqDB search
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA
DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD
KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV
LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM
KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV
FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH
TLTPEKPHLKTQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgctccgccccccgccgcctccttctcgccctccgaggtccagcggcgcctg
gcggccggcgcgtgctgggtccgccgcggggcccgcctctacgacctctccagcttcgtg
cggcaccacccggggggcgagcagctgctgcgggccagggcgggccaggacatcagcgcc
gacctggacgggccgccgcacaggcactcggccaacgcgcgccgctggctggagcagtac
tacgtgggagagctccgcggggagcagcagggctccatggagaacgagcctgtagccctt
gaggaaactcagaagacagatcctgctatggaaccacggttcaaagtggtggattgggac
aaggacctggtggactggcgaaagcctctcctgtggcaggtgggccacttgggagagaag
tacgatgagtgggttcaccagccggtgaccaggcccatccgcctcttccactcagacctc
attgagggcctctctaagactgtctggtacagtgtccccatcatctgggtgcccctggtg
ctgtatctcagctggtcctactaccgaacctttgcccagggcaacgtccgactcttcacg
tcatttacaacagagtacacggtggcagtgcccaagtccatgttccccgggctcttcatg
ctggggacattcctctggagcctcatcgagtacctcatccaccgcttcctgttccacatg
aagccccccagcgacagctattacctcatcatgctgcacttcgtcatgcacggccagcac
cacaaggcacccttcgacggctcccgcctggtcttcccccctgtgccagcctccctggtg
atcggcgtcttctacttgtgcatgcagctcatcctgcccgaggcagtagggggcactgtg
tttgcggggggcctcctgggctacgtcctctatgacatgacccattactacctgcacttt
ggctcgccgcacaagggctcctacctgtacagcctgaaggcccaccacgtcaagcaccac
tttgcacatcagaagtcaggatttggtatcagcactaaattgtgggattactgtttccac
accctcactccagagaaaccccacctgaagacgcagtga

DBGET integrated database retrieval system