KEGG   Homo sapiens (human): 80271Help
Entry
80271             CDS       T01001                                 

Gene name
ITPKC, IP3-3KC, IP3KC
Definition
inositol-trisphosphate 3-kinase C (EC:2.7.1.127)
Orthology
K00911  
1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 683 aa AA seqDB search
MRRCPCRGSLNEAEAGALPAAARMGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWA
RTEGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSL
RTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEASPWTQPGVHGPWTELETHG
SQTQPERVKSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGP
WTEPYTDGSQKKQDTEAARKQPGTGGFQIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPED
GPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSA
SSFDESEDDVVAGGGGASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGN
FQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGP
SIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQW
RETMSSTSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLE
ELREALEISPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEG
NREDGYLWGLDNMICLLQGLAQS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgctgcccgtgccgtgggagcctgaacgaggcggaggccggggcgctgcccgcg
gcggcccgcatgggactggaggcgccgcgaggagggcggcggcggcagccgggacagcag
cgacctgggcccggcgcaggggccccggcggggcggccggaggggggcgggccctgggcc
cggacagaggggtccagcctccacagcgagcctgagagggccggcctcgggcctgcgccg
gggacagagagtccgcaggcagaattctggacagacggacagactgagcccgcggcagct
ggccttggagtagagaccgagaggcccaagcaaaagacggagccagacaggtccagcctc
cggacgcatctagaatggagctggtcagagctggagacgacttgtctttggacggagacc
gggacagatggcctttggactgatccgcacaggtccgacctccagtttcagcccgaggag
gccagcccctggacacagccaggggttcatgggccctggacagagctggaaacgcatggg
tcacagactcagccagagagggtcaagtcctgggctgataacctctggacccaccagaac
agttccagcctccagactcacccagaaggagcctgtccctcaaaagagccaagtgctgat
ggctcctggaaagaattgtatactgatggctccaggacacaacaggatattgaaggtccc
tggacagagccatatactgatggctcccagaaaaaacaggatactgaagcagccaggaaa
cagcctggcactggtggtttccaaatacaacaggatactgatggctcctggacacaacct
agcactgacggttcccagacagcacctgggacagactgcctcttgggagagcctgaggat
ggcccattagaggaaccagagcctggagaattgctgactcacctgtactctcacctgaag
tgtagccccctgtgccctgtgccccgcctcatcattacccctgagacccctgagcctgag
gcccagccagtgggacccccctcccgggttgaggggggcagcggcggcttctcctctgcc
tcttctttcgacgagtctgaggatgacgtggtggccgggggcggaggtgccagcgatccc
gaggacaggtctgggagcaaaccctggaagaagctgaagacagttctgaagtattcaccc
tttgtggtctccttccgaaaacactacccttgggtccagctttctggacatgctgggaac
ttccaggcaggagaggatggtcggattctgaaacgtttctgtcagtgtgagcagcgcagc
ctggagcagctgatgaaagacccgctgcgacctttcgtgcctgcctactatggcatggtg
ctgcaggatggccagaccttcaaccagatggaagacctcctggctgactttgagggcccc
tccattatggactgcaagatgggcagcaggacctatctggaagaggagctagtgaaggca
cgggaacgtccccgtccccggaaggacatgtatgagaagatggtggctgtggaccctggg
gcccctacccctgaggagcatgcccagggtgcagtcaccaagccccgctacatgcagtgg
agggaaaccatgagctccacctctaccctgggcttccggatcgagggcatcaagaaggca
gatgggacctgtaacaccaacttcaagaagacgcaggcactggagcaggtgacaaaagtg
ctggaggacttcgtggatggagaccacgtcatcctgcaaaagtacgtggcatgcctagaa
gaacttcgtgaagctctggagatctcccccttcttcaagacccacgaggtggtaggcagc
tccctcctcttcgtgcacgaccacaccggcctggccaaggtctggatgatagacttcggc
aagacggtggccttgcccgaccaccagacgctcagccacaggctgccctgggctgagggc
aaccgtgaggacggctacctctggggcctggacaacatgatctgcctcctgcaggggctg
gcacagagctga

DBGET integrated database retrieval system