KEGG   Homo sapiens (human): 8050Help
Entry
8050              CDS       T01001                                 

Gene name
PDHX, DLDBP, E3BP, OPDX, PDX1, proX
Definition
pyruvate dehydrogenase complex, component X
Orthology
K13997  
dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 486 aa AA seqDB search
MQSGGAEGSPGAGRTGRGPGSGKAPPAEISSGAPDFPGGDPIKILMPSLSPTMEEGNIVK
WLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEG
EDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKH
SLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSY
PRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKV
RQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLT
PIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPP
QACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLE
NPIRLA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaggcggcgctgagggcagcccgggggcggggcgaacggggcgggggccgggg
tctggtaaggccccgccggctgagatatccagcggcgcacctgacttcccgggaggtgat
cccattaagatactaatgccatcactgtctcctacaatggaagaaggaaacattgtgaaa
tggctgaaaaaggaaggtgaagcggtgagtgctggagatgcattatgtgaaattgagact
gacaaagctgtggttaccttagatgcaagtgatgatggaatcttggccaaaatcgtggtt
gaagaaggaagtaaaaatatacggctaggttcactaattggtttgatagtagaagaagga
gaagattggaaacatgttgaaattcccaaagacgtaggtcctccaccaccagtttcaaaa
ccttcagagcctcgcccctcaccagaaccacagatttccatccctgtcaagaaggaacac
atacccgggacactacggttccgtttaagtccagctgcccgcaatattctggaaaaacac
tcactggatgctagccagggcacagccactggccctcgggggatattcactaaagaggat
gctctcaaacttgtccagttgaaacaaacgggcaagattaccgagtccagaccaactcca
gcccccacagccactcccacagcaccttcgcccctacaggccacagctggaccatcttat
ccccggcctgtgatcccaccagtatcaactcctggacaacccaatgcagtgggcacattc
actgaaatccccgccagcaatattcgaagagttattgccaagagattaactgaatctaaa
agtactgtacctcatgcatatgctactgctgactgtgaccttggagctgttttaaaagtt
aggcaagatctggtcaaagatgacattaaagtatcagtaaatgattttatcatcaaggca
gcagctgttacccttaaacaaatgccagatgttaatgtaagctgggatggagagggccca
aagcaactgccatttattgacatttcagtggctgtggcaacagataaaggcttacttact
ccaatcataaaagatgctgctgctaaaggtatccaggaaattgctgactctgtaaaggct
ctatcaaagaaagcaagagatggaaaattgttgcctgaagaataccaaggaggatctttt
agtatttccaacttggggatgtttggcatcgacgaatttactgcagtgattaaccctcct
caggcctgcattttggcggttgggaggttccgacctgtgctgaagctcactgaggatgaa
gagggaaatgccaaactgcagcagcgccagctcataacagtcacaatgtcaagtgacagt
cgagtggttgatgacgaactggcaaccaggtttcttaaaagttttaaagcaaacctagag
aatcctatccgacttgcctag

DBGET integrated database retrieval system