KEGG   Homo sapiens (human): 80781Help
Entry
80781             CDS       T01001                                 

Gene name
COL18A1, KNO, KNO1, KS
Definition
(RefSeq) collagen, type XVIII, alpha 1
  KO
K06823  
collagen, type XVIII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00271  
Polymicrogyria
H00805  
Vitreoretinal degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    80781 (COL18A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   80781 (COL18A1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRS; receptor-type tyrosine-protein phosphatase S [KO:K06778]
     80781 (COL18A1)
 2. Integrin Family
  Beta1 integrins
   VLA-5
    ITGB1; integrin beta 1 [KO:K05719]
     80781 (COL18A1)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     80781 (COL18A1)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   80781 (COL18A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   80781 (COL18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 1516 aa AA seqDB search
MAPYPCGCHILLLLFCCLAAARANLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADT
TTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKG
IRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGA
HTTEAGTLPAPTPSPPSLGRPWAPLTGPSVPPPSSERISEEVGLLQLLGDPPPQQVTQTD
DPDVGLAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVL
LGVKLSGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDC
EEFQRMPLARSSRGLELEPGAGLFVAQAGGADPDKFQGVIAELKVRRDPQVSPMHCLDEE
GDDSDGASGDSGSGLGDARELLREETGAALKPRLPAPPPVTTPPLAGGSSTEDSRSEEVE
EQTTVASLGAQTLPGSDSVSTWDGSVRTPGGRVKEGGLKGQKGEPGVPGPPGRAGPPGSP
CLPGPPGLPCPVSPLGPAGPALQTVPGPQGPPGPPGRDGTPGRDGEPGDPGEDGKPGDTG
PQGFPGTPGDVGPKGDKGDPGVGERGPPGPQGPPGPPGPSFRHDKLTFIDMEGSGFGGDL
EALRGPRGFPGPPGPPGVPGLPGEPGRFGVNSSDVPGPAGLPGVPGREGPPGFPGLPGPP
GPPGREGPPGRTGQKGSLGEAGAPGHKGSKGAPGPAGARGESGLAGAPGPAGPPGPPGPP
GPPGPGLPAGFDDMEGSGGPFWSTARSADGPQGPPGLPGLKGDPGVPGLPGAKGEVGADG
VPGFPGLPGREGIAGPQGPKGDRGSRGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDG
SVLSVPGPEGRPGFAGFPGPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSPDGGALGPAQ
KGAKGEPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGLKGEKGEPGDASLGFGMRGMPG
PPGPPGPPGPPGTPVYDSNVFAESSRPGPPGLPGNQGPPGPKGAKGEVGPPGPPGQFPFD
FLQLEAEMKGEKGDRGDAGQKGERGEPGGGGFFGSSLPGPPGPPGPRGYPGIPGPKGESI
RGQPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTISVPGPPGPPGPPGPPGT
MGASSGVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGT
DNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSY
VHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFR
AFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKD
VLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHH
AYIVLCIENSFMTASK
NT seq 4551 nt NT seq  +upstreamnt  +downstreamnt
atggctccctacccctgtggctgccacatcctgctgctgctcttctgctgcctggcggct
gcccgggccaacctgctgaacctgaactggctttggttcaataatgaggacaccagccat
gcagctaccacgatccctgagccccaggggcccctgcctgtgcagcccacagcagatacc
accacacacgtgaccccccggaatggttccacagagccagcgacagcccctggcagccct
gagccaccctcagagctgctggaagatggccaggacacccccacttctgccgagagcccg
gacgcgccagaggagaacattgccggtgtcggagccgagatcctgaacgtggccaaaggc
atccggagcttcgtccagctgtggaatgacactgtccccactgagagcttggccagggcg
gaaaccctggtcctggagactcctgtgggcccccttgccctcgctgggccttccagcacc
ccccaggagaatgggaccactctctggcccagccgtggcattcctagctctccgggcgcc
cacacaaccgaggctggcaccttgcctgcacccaccccatcgcctccctccctgggcagg
ccctgggcaccactcacggggccctcagtgccaccaccatcttcagagcgcatcagcgag
gaggtggggctgctgcagctccttggggaccccccgccccagcaggtcacccagacggat
gaccccgacgtcgggctggcctacgtctttgggccagatgccaacagtggccaagtggcc
cggtaccacttccccagcctcttcttccgtgacttctcactgctgttccacatccggcca
gccacagagggcccaggggtgctgttcgccatcacggactcggcgcaggccatggtcttg
ctgggcgtgaagctctctggggtgcaggacgggcaccaggacatctccctgctctacaca
gaaccaggtgcaggccagacccacacagccgccagcttccggctccccgccttcgtcggc
cagtggacacacttagccctcagtgtggcaggtggctttgtggccctctacgtggactgt
gaggagttccagagaatgccgcttgctcggtcctcacggggcctggagctggagcctggc
gccgggctcttcgtggctcaggcggggggagcggaccctgacaagttccagggggtgatc
gctgagctgaaggtgcgcagggacccccaggtgagccccatgcactgcctggacgaggaa
ggcgatgactcagatggggcatccggagactctggcagcgggctcggggacgcccgggag
cttctcagggaggagacgggcgcggccctaaaacccaggctccccgcgccaccccccgtc
accacgccacccttggctggaggcagcagcacggaagattccagaagtgaagaagtcgag
gagcagaccacggtggcttcgttaggagctcagacacttcctggctcagattctgtctcc
acgtgggacgggagtgtccggacccctgggggccgcgtgaaagagggcggcctgaagggg
cagaaaggggagccaggtgttccgggcccacctggccgggcaggccccccaggatcccca
tgcctacctggtcccccgggtctcccgtgcccagtgagtcccctgggtcctgcaggccca
gcgttgcaaactgtccccggaccacaaggacccccagggcctccggggagggacggcacc
cctggaagggacggcgagccgggcgaccccggtgaagacggaaagccgggcgacaccggg
ccacaaggcttccccgggactccaggggacgtaggtcccaagggcgacaagggagaccct
ggggttggagagagagggcccccaggaccccaagggcctccagggcccccaggaccctcc
ttcagacacgacaagctgaccttcattgacatggagggatctggcttcgggggcgatctg
gaggccctgcggggtcctcgaggcttccctggacctcccggaccccccggtgtcccaggc
ctgcccggcgagccaggccgctttggggtgaacagctccgacgtcccaggacccgccggc
cttcctggtgtgcctgggcgcgagggtccccccgggtttcctggcctcccgggaccccca
ggccctccgggaagagaggggcccccaggaaggactgggcagaaaggcagcctgggtgaa
gcaggcgccccaggacataaggggagcaagggagcccccggtcctgctggtgctcgtggg
gagagcggcctggcaggagcccccggacctgctggaccaccaggcccccctgggccccct
gggcccccaggaccaggactccccgctggatttgatgacatggaaggctccggggggccc
ttctggtcaacagcccgaagcgctgatgggccacagggacctcccggcctgccgggactt
aagggggatcctggcgtgcctgggctgccgggggcgaagggagaagttggagcagatgga
gtccccgggttccccggcctccctggcagagagggcattgctgggccccaggggccaaag
ggagacagaggcagccggggagaaaagggagatccagggaaggacggagtcgggcagccg
ggcctccctggcccccccggacccccgggacctgtggtctacgtgtcggagcaggacgga
tccgtcctgagcgtgccgggacctgagggccggccgggtttcgcaggctttcccggacct
gcaggacccaagggcaacctgggctctaagggcgaacgaggctccccgggacccaagggt
gagaagggtgaaccgggcagcatcttcagccccgacggcggtgccctgggccctgcccag
aaaggagccaagggagagccgggcttccgaggacccccgggtccatacggacggccgggg
tacaagggagagattggctttcctggacggccgggtcgccccgggatgaacggattgaaa
ggagagaaaggggagccgggagatgccagccttggatttggcatgaggggaatgcccggc
cccccaggacctccagggcccccaggccctccagggactcctgtttacgacagcaatgtg
tttgctgagtccagccgccccgggcctccaggattgccagggaatcagggccctccagga
cccaagggcgccaaaggagaagtgggcccccccggaccaccagggcagtttccgtttgac
tttcttcagttggaggctgaaatgaagggggagaagggagaccgaggtgatgcaggacag
aaaggcgaaaggggggagcccgggggcggcggtttcttcggctccagcctgcccggcccc
cccggccccccaggcccacgtggctaccctgggattccaggtcccaagggagagagcatc
cggggccagcccggcccacctggacctcagggaccccccggcatcggctacgaggggcgc
cagggccctcccggccccccaggccccccagggcccccttcatttcctggccctcacagg
cagactatcagcgttcccggccctccgggcccccctgggccccctgggccccctggaacc
atgggcgcctcctcaggggtgaggctctgggctacacgccaggccatgctgggccaggtg
cacgaggttcccgagggctggctcatcttcgtggccgagcaggaggagctctacgtccgc
gtgcagaacgggttccggaaggtccagctggaggcccggacaccactcccacgagggacg
gacaatgaagtggccgccttgcagccccccgtggtgcagctgcacgacagcaacccctac
ccgcggcgggagcacccccaccccaccgcgcggccctggcgggcagatgacatcctggcc
agcccccctcgcctgcccgagccccagccctaccccggagccccgcaccacagctcctac
gtgcacctgcggccggcgcgacccacaagcccacccgcccacagccaccgcgacttccag
ccggtgctccacctggttgcgctcaacagccccctgtcaggcggcatgcggggcatccgc
ggggccgacttccagtgcttccagcaggcgcgggccgtggggctggcgggcaccttccgc
gccttcctgtcctcgcgcctgcaggacctgtacagcatcgtgcgccgtgccgaccgcgca
gccgtgcccatcgtcaacctcaaggacgagctgctgtttcccagctgggaggctctgttc
tcaggctctgagggtccgctgaagcccggggcacgcatcttctcctttgacggcaaggac
gtcctgaggcaccccacctggccccagaagagcgtgtggcatggctcggaccccaacggg
cgcaggctgaccgagagctactgtgagacgtggcggacggaggctccctcggccacgggc
caggcctcctcgctgctggggggcaggctcctggggcagagtgccgcgagctgccatcac
gcctacatcgtgctctgcattgagaacagcttcatgactgcctccaagtag

DBGET integrated database retrieval system