KEGG   Homo sapiens (human): 81031Help
Entry
81031             CDS       T01001                                 

Gene name
SLC2A10, ATS, GLUT10
Definition
solute carrier family 2 (facilitated glucose transporter), member 10
Orthology
K08147  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 10
Organism
hsa  Homo sapiens (human)
Disease
H00919  
Arterial tortuosity syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.1
AA seq 541 aa AA seqDB search
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC
IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL
SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL
FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL
LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN
EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL
LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggccactccccacctgtcctgcctttgtgtgcctctgtgtctttgctgggtggcctg
acctttggttatgaactggcagtcatatcaggtgccctgctgccactgcagcttgacttt
gggctaagctgcttggagcaggagttcctggtgggcagcctgctcctgggggctctcctc
gcctccctggttggtggcttcctcattgactgctatggcaggaagcaagccatcctcggg
agcaacttggtgctgctggcaggcagcctgaccctgggcctggctggttccctggcctgg
ctggtcctgggccgcgctgtggttggcttcgccatttccctctcctccatggcttgctgt
atctacgtgtcagagctggtggggccacggcagcggggagtgctggtgtccctctatgag
gcaggcatcaccgtgggcatcctgctctcctatgccctcaactatgcactggctggtacc
ccctggggatggaggcacatgttcggctgggccactgcacctgctgtcctgcaatccctc
agcctcctcttcctccctgctggtacagatgagactgcaacacacaaggacctcatccca
ctccagggaggtgaggcccccaagctgggcccggggaggccacggtactcctttctggac
ctcttcagggcacgcgataacatgcgaggccggaccacagtgggcctggggctggtgctc
ttccagcaactaacagggcagcccaacgtgctgtgctatgcctccaccatcttcagctcc
gttggtttccatgggggatcctcagccgtgctggcctctgtggggcttggcgcagtgaag
gtggcagctaccctgaccgccatggggctggtggaccgtgcaggccgcagggctctgttg
ctagctggctgtgccctcatggccctgtccgtcagtggcataggcctcgtcagctttgcc
gtgcccatggactcaggcccaagctgtctggctgtgcccaatgccaccgggcagacaggc
ctccctggagactctggcctgctgcaggactcctctctacctcccattccaaggaccaat
gaggaccaaagggagccaatcttgtccactgctaagaaaaccaagccccatcccagatct
ggagacccctcagcccctcctcggctggccctgagctctgccctccctgggccccctctg
cccgctcgggggcatgcactgctgcgctggaccgcactgctgtgcctgatggtctttgtc
agtgccttctcctttgggtttgggccagtgacctggcttgtcctcagcgagatctaccct
gtggagatacgaggaagagccttcgccttctgcaacagcttcaactgggcggccaacctc
ttcatcagcctctccttcctcgatctcattggcaccatcggcttgtcctggaccttcctg
ctctacggactgaccgctgtcctcggcctgggcttcatctatttatttgttcctgaaaca
aaaggccagtcgttggcagagatagaccagcagttccagaagagacggttcaccctgagc
tttggccacaggcagaactccactggcatcccgtacagccgcatcgagatctctgcggcc
tcctga

DBGET integrated database retrieval system