KEGG   Homo sapiens (human): 81608Help
Entry
81608             CDS       T01001                                 

Gene name
FIP1L1, FIP1, Rhe, hFip1
Definition
factor interacting with PAPOLA and CPSF1
Orthology
K14405  
pre-mRNA 3'-end-processing factor FIP1
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    81608 (FIP1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q12
AA seq 588 aa AA seqDB search
MSAGEVERLVSELSGGTGGDEEEEWLYGDENEVERPEEENASANPPSGIEDETAENGVPK
PKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTK
VKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRI
RMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGRTGNSEKETALPSTKA
EFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYGRAESPDLRRLPGAID
VIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPTHLPPPPFL
PPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRSARAFPY
GNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERERTRERE
RERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRS
NSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcgaggtcgagcgcctagtgtcggagctgagcggcgggaccggaggggat
gaggaggaagagtggctctatggcgatgaaaatgaagttgaaaggccagaagaagaaaat
gccagtgctaatcctccatctggaattgaagatgaaactgctgaaaatggtgtaccaaaa
ccgaaagtgactgagaccgaagatgatagtgatagtgacagcgatgatgatgaagatgat
gttcatgtcactataggagacattaaaacgggagcaccacagtatgggagttatggtaca
gcacctgtaaatcttaacatcaagacagggggaagagtttatggaactacagggacaaaa
gtcaaaggagtagaccttgatgcacctggaagcattaatggagttccactcttagaggta
gatttggattcttttgaagataaaccatggcgtaaacctggtgctgatctttctgattat
tttaattatgggtttaatgaagatacctggaaagcttactgtgaaaaacaaaagaggata
cgaatgggacttgaagttataccagtaacctctactacaaataaaattacggccgaagac
tgtactatggaagttacaccaggtgcagagatccaagatggcagattcaatctttttaag
gtacagcagggaagaactggaaactcagagaaagaaactgcccttccatctacaaaagct
gagtttacttctcctccttctttgttcaagactgggcttccaccgagcagaaacagcact
tcttctcagtctcagacaagtactgcctccagaaaagccaattcaagcgttgggaagtgg
caggatcgatatgggagggccgaatcacctgatctaaggagattacctggggcaattgat
gttatcggtcagactataactatcagccgagtagaaggcaggcgacgggcaaatgagaac
agcaacatacaggtcctttctgaaagatctgctactgaagtagacaacaattttagcaaa
ccacctccgtttttccctccaggagctcctcccactcaccttccacctcctccatttctt
ccacctcctccgactgtcagcactgctccacctctgattccaccaccgggtattccaata
actgtaccacctccaggttttcctcctccaccaggcgctccacctccatctcttatacca
acaatagaaagtggacattcctctggttatgatagtcgttctgcacgtgcatttccatat
ggcaatgttgcctttccccatcttcctggttctgctccttcgtggcctagtcttgtggac
accagcaagcagtgggactattatgccagaagagagaaagaccgagatagagagagagac
agagacagagagcgagaccgtgatcgggacagagaaagagaacgcaccagagagagagag
agggagcgtgatcacagtcctacaccaagtgttttcaacagcgatgaagaacgatacaga
tacagggaatatgcagaaagaggttatgagcgtcacagagcaagtcgagaaaaagaagaa
cgacatagagaaagacgacacagggagaaagaggaaaccagacataagtcttctcgaagt
aatagtagacgtcgccatgaaagtgaagaaggagatagtcacaggagacacaaacacaaa
aaatctaaaagaagcaaagaaggaaaagaagcgggcagtgagcctgcccctgaacaggag
agcaccgaagctacacctgcagaatag

DBGET integrated database retrieval system