KEGG   Homo sapiens (human): 8175Help
Entry
8175              CDS       T01001                                 

Gene name
SF3A2, PRP11, PRPF11, SAP62, SF3a66
Definition
(RefSeq) splicing factor 3a subunit 2
  KO
K12826  
splicing factor 3A subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    8175 (SF3A2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    8175 (SF3A2)
 Complex B
    8175 (SF3A2)
 Complex C
   U2 SnRNP specific factors
    8175 (SF3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 464 aa AA seqDB search
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVT
KQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASG
VHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP
APGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacttccagcatcgccccgggggcaagaccgggagcgggggcgtggcctcctcctcc
gagagcaaccgtgaccgcagggagcgcctccggcagctggccctggagaccatcgacatc
aacaaggacccgtacttcatgaagaaccacctgggctcctatgaatgcaaactctgcctg
acacttcacaacaatgaggggagctacctggcacatacgcaggggaagaagcaccagacc
aacctggcccggcgagcagccaaggaggccaaggaggcccctgcccagcccgcgcctgag
aaggtcaaggtggaggtgaagaagtttgtgaagatcggccgcccgggctacaaagtgacc
aagcagagagactcggagatgggccagcagagcctcctcttccagattgactaccctgag
atcgccgagggcatcatgccacgtcaccgcttcatgtctgcgtacgagcagaggatcgag
cctccggaccggcgctggcagtacctgctcatggccgccgagccctacgagaccattgcc
ttcaaggtgccgagcagagagatcgacaaggcggagggcaagttctggacacactggaac
cgggagaccaagcagttcttcctccagttccactttaagatggagaagcccccggctcca
cccagcctccctgctggcccccctggggtgaagcggcctccacccccgctgatgaacggt
ctgccccctcggccaccgctgcctgagtctttgccaccgcccccgccaggaggcctgcct
ctgccacccatgccccccacagggcctgcgccctcagggcccccgggaccaccccagcta
cccccgccagctccaggggtccaccccccggccccagtggtgcatccccctgcatctggg
gtccatcccccagctcctggcgtccaccccccagctcctggcgtccatcccccagcccct
ggggtccacccaccaacctctggggtccaccccccagctcctggagtccaccctccagcc
cccggggttcacccaccagcccccggagtccacccaccagcccctggggttcacccacca
gccccaggggtccatcctcccccatcagcgggggttcacccccaggccccgggggtgcac
ccagcagcccccgccgttcaccctcaggccccaggggtgcacccaccagccccagggatg
caccctcaggccccgggggtccacccccaacctcccggggtccatccgtcggctcctggg
gtccaccctcagcctccgggagttcacccctcaaatcctggggtgcaccccccaactccc
atgcccccaatgctgaggcccccacttccctccgaaggcccagggaacatacctccccct
cccccaaccaactga

DBGET integrated database retrieval system