KEGG   Homo sapiens (human): 8295Help
Entry
8295              CDS       T01001                                 

Gene name
TRRAP, PAF350/400, PAF400, STAF40, TR-AP, Tra1
Definition
(RefSeq) transformation/transcription domain associated protein
  KO
K08874  
transformation/transcription domain-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    8295 (TRRAP)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   8295 (TRRAP)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8295 (TRRAP)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     8295 (TRRAP)
    STAGA complex
     8295 (TRRAP)
    TFTC complex
     8295 (TRRAP)
    TIP60 complex
     8295 (TRRAP)
    SAGA complex
     8295 (TRRAP)
    SLIK complex
     8295 (TRRAP)
    NuA4 complex
     8295 (TRRAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.2-q22.1
AA seq 3859 aa AA seqDB search
MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYST
FLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRF
LETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIP
ENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYK
LNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE
LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESIL
IGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC
KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAV
EAALPGVPTAPAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQT
FQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQFIPNKQLQPKETQIYIKLVKYAMQAL
DIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVE
RISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGS
VSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFL
PLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQT
LVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGG
SNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYR
RQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQ
ALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSE
ENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSY
IVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSN
GAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQA
MHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQP
RLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLP
QSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSL
TLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRC
PLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIK
FLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGGA
QTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQERH
RKENMAATNWKEPKLLAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEI
PKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNPE
GDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLRR
LMTFAWPCLLSKACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIV
RQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH
LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVN
SVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNF
LIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLMTVEQPN
QVNYGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRLM
SIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYEKATNANPSQLFGTLMILKSACS
NNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSM
EMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILLVKMM
TYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFE
VFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGAMLPS
ITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELS
EKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKIL
SDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTH
NLWFRSTLMLEHQAFEKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDM
WAGLWQKRCKYSETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEYQLW
EDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEM
AWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQI
IELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQ
GKPTWSGMHSSSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDI
LSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYFTKEMTAE
FYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFVKERQLHLGVSAI
TCYLHACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLT
CLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC
SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSD
AKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQF
TTDFDFSVPGSMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEI
PGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVMNDACLTESR
REERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVEDNPSSLSLVEIYKQR
CAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKEVQSNMVPRSMLKEWALHTFP
NATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGD
LDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIA
WHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVA
AANSLDNLCRMDPAWHPWL
NT seq 11580 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgttgcaacacagggggccacggtggttgaccagaccactttgatgaaaaag
taccttcagtttgtggcagctctcacagatgtgaatacacctgatgaaacaaagttgaaa
atgatgcaagaagttagtgaaaattttgagaatgtcacgtcatctcctcagtattctaca
ttcctagaacatatcatccctcgattccttacatttctccaagatggagaagttcagttt
cttcaggagaaaccagcacagcaactgcggaagctcgtacttgaaataattcatagaata
ccaaccaacgaacatcttcgtcctcacacaaaaaatgttttgtctgtgatgtttcgcttt
ttagagacggaaaatgaagaaaatgttcttatttgtctaagaataattattgagctacac
aaacagttcaggccaccgatcacacaagaaattcatcattttctggattttgtgaaacag
atttacaaggagcttccaaaagtagtgaaccgctactttgagaaccctcaagtgatcccc
gagaacacagtgcctcccccagaaatggttggtatgataacaacgattgctgtgaaagtc
aacccggagcgtgaggacagtgagactcgaacacattccatcattccgaggggatcactt
tctctgaaagtgttggcagaattgcccattattgttgttttaatgtatcagctctacaaa
ctgaacatccacaatgttgttgctgagtttgtgcccttgatcatgaacaccattgccatt
caggtgtctgcacaagcgaggcaacataagctttacaacaaggagttgtatgctgacttc
attgctgctcagattaaaacattgtcatttttagcttacattatcaggatttaccaggag
ttggtgactaagtattctcagcagatggtgaaaggaatgctccagttactttcaaattgt
ccagcagagactgcacacctcagaaaggagcttctgattgctgccaaacacatcctcacc
acagagctgagaaaccagttcattccttgcatggacaagctgtttgatgaatccatacta
attggctcaggatatactgccagagagactctaaggcccctcgcctacagcacgctggcc
gacctcgtgcaccatgtccgccagcacctgcccctcagcgacctctccctcgccgtccag
ctcttcgccaagaacatcgacgatgagtccctgcccagcagcatccagaccatgtcctgc
aagctcctgctgaacctggtggactgcatccgttccaagagcgagcaggagagtggcaat
gggagagacgtcctgatgcggatgctggaggttttcgttctcaaattccacacaattgct
cggtaccagctctctgccatttttaagaagtgtaagcctcagtcagaacttggagccgtg
gaagcagctctgcctggggtgcccactgcccctgcagctcctggccctgctccctcccca
gcccctgtccctgccccacctccacccccgcccccacccccacctgccacccctgtgacc
ccggcccccgtgcctcccttcgagaagcaaggagaaaaggacaaggaagacaagcagaca
ttccaagtcacagactgtcgaagtttggtcaaaaccttggtgtgtggtgtcaagacaatc
acgtggggcataacatcatgcaaagcacctggtgaagctcagttcattcccaacaagcag
ttacaacccaaagagacacagatttacatcaaacttgtgaaatatgcaatgcaagcttta
gatatttatcaggtccagatagcaggaaatggacagacatacatccgtgtggccaactgc
cagactgtgagaatgaaagaggagaaggaggtattggagcatttcgctggtgtgttcaca
atgatgaaccccttaacgttcaaagaaatcttccaaactacggtcccttatatggtggag
agaatctcaaaaaattatgctcttcagattgttgccaattccttcttggcaaatcctact
acctctgctctgtttgctacgattctggtggaatatctccttgatcgcctgccagaaatg
ggctccaacgtggagctctccaacctgtacctcaagctgttcaagctggtctttggctct
gtctccctctttgcagctgaaaatgaacaaatgctgaagcctcacttgcacaagattgtg
aacagctctatggagctcgcgcagactgccaaggaaccctacaactacttcttgctgcta
cgggcgctgtttcgctctattggtggaggtagccacgatctcttgtatcaggagttcttg
cctctccttccaaacctcctgcaagggctgaacatgcttcagagtggcctgcacaagcag
cacatgaaggacctctttgtggagctgtgtctcaccgtccctgtgcggctgagctcgctt
ttgccgtacctgcccatgcttatggatcccttggtgtctgcactcaatgggtctcagaca
ttggtcagccaaggcctcaggacgctggagctgtgtgtggacaacctgcagcccgacttc
ctctacgaccacatccagccggtgcgcgcagagctcatgcaggctctgtggcgcacctta
cgcaaccctgctgacagcatctcccacgtggcctaccgtgtgctcggtaagtttggcggc
agtaacaggaagatgctgaaggagtcgcagaagctgcactacgttgtgaccgaggttcag
ggccccagcatcactgtggagttttccgactgcaaagcttctctccagctccccatggag
aaggccattgaaactgctctggactgcctgaaaagcgccaacactgagccctactaccgg
aggcaggcgtgggaagtgatcaaatgcttcctggtggccatgatgagcctggaggacaac
aagcacgcactctaccagctcctggcacaccccaactttacagaaaagaccatccccaat
gttatcatctcacatcgctacaaagcccaggacactccagcccggaagacttttgagcag
gccctgacaggcgccttcatgtctgctgtcattaaggacctgcggcccagcgccctgccc
tttgtcgccagcttgatccgccactatacgatggtggcagtcgcccagcagtgtggccct
ttcttgctgccttgctaccaggtgggcagccagcccagcacagccatgtttcacagtgaa
gaaaatggctcgaaaggaatggatcctttggttctcattgatgcaattgctatttgtatg
gcatatgaagaaaaggagctttgcaaaatcggggaggtggccctagctgtgatatttgat
gttgcaagtatcatcctgggctccaaggagagggcctgccagctgcccctgttttcttac
atcgtggagcgcctgtgtgcatgttgttatgaacaggcgtggtatgcaaagctggggggt
gtggtgtctattaagtttctcatggagcggctgcctctcacttgggttctccagaaccag
cagacattcctgaaagcacttctctttgtcatgatggacttaactggagaggtttccaat
ggggcagtcgctatggcaaagaccacgctggagcagcttctgatgcggtgcgcaacgcct
ttaaaagacgaggagagagccgaagagatcgtggccgcccaggaaaagtctttccaccat
gtgacacacgacttggttcgagaagtcacctctccaaactccactgtgaggaagcaggcc
atgcattcgctgcaggtgttggcccaggtcactgggaagagtgtcacggtgatcatggaa
ccccacaaagaggtcctgcaggatatggtcccccctaagaagcacctgctccgacaccag
cctgccaacgcacagattggcctgatggaggggaacacgttctgtaccacgttgcagccc
aggctcttcacaatggaccttaacgtggtggagcataaggtgttctacacagagctgttg
aatttgtgtgaggctgaagattcagctttaacaaagctgccctgttataaaagccttccg
tcactcgtacctttacgaattgcggcattaaatgcacttgctgcctgcaattaccttcct
cagtccagggagaaaatcatcgctgcactcttcaaagccctgaattccaccaatagtgag
ctccaagaggccggagaagcctgtatgagaaagtttttagaaggtgctaccatagaagtc
gatcaaatccacacacatatgcgacctttgctgatgatgctgggagattaccggagcttg
acgctgaatgttgtgaatcgcctgacttcggtcacgaggctcttcccaaattccttcaat
gataaattttgtgatcagatgatgcaacatctgcgcaagtggatggaagtggtggtgatc
acccacaaagggggccagaggagcgacggaaacgaaagcatttccgagtgcgggagatgt
cccttgtctccattctgtcagtttgaggaaatgaagatttgctcagcaattataaacctt
tttcatctgatcccggctgctcctcagacactggtgaagcctttgctagaggttgtcatg
aaaacggagcgggcgatgctgatcgaggcggggagtccattccgagagcccctgatcaag
ttcctgactcgacatccctcgcagacagtggagctgttcatgatggaagccacactgaac
gatccccagtggagcagaatgtttatgagttttttaaaacacaaagacgccagacctctg
cgggatgtgctggctgccaaccccaacaggttcatcaccctgctgctgccggggggtgcc
cagacggctgtgcgccccggttcgcccagcaccagcaccatgcgcctggacctccagttc
caggccatcaagatcataagcattatagtgaaaaacgatgactcctggctggccagccag
cactctctggtgagccagttgcgacgtgtgtgggtgagtgagaacttccaagagaggcac
cgcaaggagaacatggcagccaccaactggaaggagcccaagctgctggcctactgcctg
ctgaactactgcaaaaggaattacggagatatagaattgctgttccagctgctccgagcc
tttactggtcgttttctctgcaacatgacattcttaaaagagtatatggaggaagagatt
cccaaaaattacagcatcgctcagaaacgtgccctgttctttcgctttgtagacttcaac
gaccccaacttcggagatgaattaaaagctaaagttctgcagcatatcttgaatcctgct
ttcttgtacagctttgagaagggggaaggagagcagctcttgggacctcccaatccagaa
ggagataacccagaaagcatcaccagtgtgtttattaccaaggtcctggaccccgagaag
caggcggacatgctggactcgctgcggatctacctgctgcagtacgccacgctgctggtg
gagcacgccccccaccacatccatgacaacaacaagaaccgcaacagcaagctgcgccgc
ctcatgaccttcgcctggccctgcctgctctccaaggcctgcgtggacccagcctgcaag
tacagcggacacttgctcctggcgcacattatcgccaaattcgccatacacaagaagatc
gtcctgcaggtttttcatagtctcctcaaggctcacgcaatggaagctcgagcgatcgtc
agacaggcgatggccattctgaccccggcggtgccggccaggatggaggacgggcaccag
atgctgacccactggacccggaagatcattgtggaggaggggcacaccgtcccgcagctg
gtccacattctgcacctgatagtgcaacacttcaaggtgtactacccggtacggcaccac
ttggtgcagcacatggtgagcgccatgcagaggctgggcttcacgcccagtgtcaccatc
gagcagaggcggctggccgtggacctgtctgaagtcgtcatcaagtgggagctgcagagg
atcaaggaccagcagccggattcagatatggacccaaattccagtggagaaggagtcaat
tctgtctcatcctccattaagagaggcctgtccgtggattctgcccaggaagtgaaacgc
tttaggacggccaccggagccatcagtgcagtctttgggaggagccagtcgctacctgga
gcagactctctcctcgccaagcccattgacaagcagcacacagacactgtggtgaacttc
cttatccgcgtggcctgtcaggttaatgacaacaccaacacagcggggtcccctggggag
gtgctctctcgccggtgtgtgaaccttctgaagactgcgttgcggccagacatgtggccc
aagtccgaactcaagctgcagtggttcgacaagctgctgatgactgtggagcagccaaac
caagtgaactatgggaatatctgcacgggcctagaagtgctgagcttcctgctaactgtc
ctccagtccccagccatcctcagtagcttcaaacctctgcagcgtggaattgccgcctgc
atgacatgtggaaacaccaaggtgttgcgagccgtccacagccttctctcgcgcctgatg
agcattttcccaacagagccgagtacttccagtgtggcctccaaatatgaagagctggag
tgcctctacgcagccgtcggaaaggtcatctatgaagggctcaccaactacgagaaggcc
accaatgccaatccctcccagctcttcgggacccttatgatcctcaagtctgcctgcagc
aacaaccccagctacatagacaggctgatctccgtctttatgcgctccctgcagaagatg
gtccgggagcatttaaaccctcaggcagcgtcaggaagcaccgaagccacctcaggtaca
agcgagctggtgatgctgagtctggagctggtgaagacgcgcctggcagtgatgagcatg
gagatgcggaagaacttcatccaggccatcctgacatccctcatcgaaaaatcaccagat
gccaaaatcctccgggctgtggtcaaaatcgtggaagaatgggtcaagaataactcccca
atggcagccaatcagacacctacactccgggagaagtccattttgcttgtgaagatgatg
acttacatagaaaaacgctttccggaagaccttgaattaaatgcccagtttttagatctt
gttaactatgtctacagggatgagaccctctctggcagcgagctgacggcgaaacttgag
cctgcctttctctctgggctgcgctgtgcccagccactcatcagggcaaagtttttcgag
gtttttgacaactccatgaaacgtcgtgtctacgagcgcttgctctatgtgacctgttcg
cagaactgggaagccatggggaaccacttctggatcaagcagtgcattgagctgcttctg
gccgtgtgtgagaagagcacccccattggcaccagctgccaaggagccatgctcccgtcc
atcaccaacgtcatcaacctggccgatagccacgaccgtgccgccttcgccatggtcaca
catgtcaagcaggagccccgggagcgggagaacagcgagtccaaagaggaggatgtagag
atagacatcgaactagctcctggggatcagaccagcacgcccaaaaccaaagaactttca
gaaaaggacattggaaaccagctgcacatgctaaccaacaggcacgacaagtttctggac
actctccgagaggtgaagactggagcgctgctcagcgctttcgttcagctgtgccacatt
tccacgacgctggcagagaagacgtgggtccagcttttccccagattgtggaagatcctc
tctgacagacagcagcatgcactcgcgggtgagataagtccatttctgtgcagcggcagt
caccaggtgcagcgggactgccagcccagcgcgctgaactgctttgtggaagccatgtcc
cagtgcgtgccgccaatccccatccgaccctgcgtcctgaagtacctggggaagacacac
aacctctggttccggtccacgctgatgttggagcaccaggcttttgaaaagggtctgagt
cttcagattaagccgaagcaaacaacggagttttatgagcaggagagcatcaccccgccg
cagcaggagatactggattcccttgcggagctttactccctgttacaagaggaagatatg
tgggctggtctgtggcagaagcggtgcaagtactcggagacagcgactgcgattgcttac
gagcagcacgggttctttgagcaggcacaagaatcctatgaaaaggcaatggataaagcc
aaaaaagaacatgagaggagtaacgcctcccctgctattttccctgaataccagctctgg
gaagaccactggattcgatgctccaaggaattgaaccagtgggaagccctgacggagtac
ggtcagtccaaaggccacatcaacccctacctcgtcctggagtgcgcctggcgggtgtcc
aactggactgccatgaaggaggcgctggtgcaggtggaagtgagctgtccgaaggagatg
gcctggaaggtgaacatgtaccgcggatacctggccatctgccaccccgaggagcagcag
ctcagcttcatcgagcgcctggtggagatggccagcagcctggccatccgcgagtggcgg
cggctgccccacgtagtgtcccacgtgcacacgcctctcctacaggcagcccagcaaatc
atcgaactccaggaagctgcacaaatcaacgcaggcttacagccaaccaacctgggaagg
aacaacagcctgcacgacatgaagacggtggtgaagacctggaggaaccgactgcccatc
gtgtctgacgacttgtcccactggagcagcatcttcatgtggaggcagcatcattaccag
ggtaaaccgacctggtccggcatgcattcatcatcgattgtaactgcctatgagaatagc
tctcagcatgatcccagttcaaataacgctatgcttggggttcatgcatcagcttcagcg
atcatccagtatggaaaaatcgcccggaaacaaggactggtcaatgtagctctggatata
ttaagtcggattcatactattccaactgttcctatcgtggattgcttccagaagattcga
cagcaagttaaatgctacctccagctggcaggcgtcatgggcaaaaacgagtgcatgcag
ggccttgaagttattgaatctacaaatttaaaatacttcacaaaagagatgacagccgaa
ttttatgcactgaagggaatgttcttggctcagatcaacaagtccgaggaggcaaacaaa
gccttctctgcagctgtgcagatgcacgatgtgctggtgaaagcctgggccatgtggggc
gactacctggagaacatctttgtgaaggagcggcagctgcacctgggcgtgtctgccatc
acctgctacctgcacgcctgccggcatcagaacgagagcaaatcgaggaaatacttagcc
aaggtgctgtggcttttgagttttgatgatgacaaaaacactttggcagatgccgtcgac
aagtactgcattggtgtgccacccatccagtggctggcctggatcccacagctgctcacc
tgcctggttggctcggagggaaagctgctcttgaacctcattagccaggttggacgcgtg
tatccccaagcggtctactttcccatccggaccctgtacctgaccctgaaaatagaacag
cgggaacgctacaagagcgatccagggcccataagagcaacagcacccatgtggcgctgc
agccgaatcatgcacatgcagcgagagctccaccccacccttctgtcttccctggaaggc
atcgtcgatcagatggtctggttcagagaaaattggcatgaagaggttctcaggcagctc
caacagggcctggcgaaatgttactccgtggcgtttgagaaaagtggagcggtgtccgat
gctaaaatcaccccccacactctcaattttgtgaagaagttggtgagcacgtttggggtg
ggcctggagaatgtgtccaacgtctcgaccatgttctccagcgcagcctctgagtctctg
gcccggcgggcgcaggccactgcacaagaccctgtctttcagaagctgaaaggccagttc
acgacggattttgacttcagcgttccaggatccatgaagcttcataatcttatttctaag
ttgaaaaagtggatcaaaatcttggaggccaagaccaagcaactccccaaattcttcctc
atagaggaaaagtgccggttcttgagcaatttctcggcacagacagctgaagtggaaatt
cctggggagtttctgatgccaaagccaacgcattattacatcaagattgcacggttcatg
ccccgggtagagattgtgcagaagcacaacaccgcagcccggcggctgtacatccgggga
cacaatggcaagatctacccatacctcgtcatgaacgacgcctgcctcacagagtcacgg
cgagaggagcgtgtgttgcagctgctgcgtctgctgaacccctgtttggagaagagaaag
gagaccaccaagaggcacttgtttttcacagtgccccgggttgtggcagtttccccacag
atgcgcctcgtggaggacaacccctcttcactttcccttgtggagatctacaagcagcgc
tgcgccaagaagggcatcgagcatgacaaccccatctcccgttactatgaccggctggct
acggtgcaggcgcggggaacccaagccagccaccaggtcctccgcgacatcctcaaggag
gttcagagtaacatggtgccgcgcagcatgctcaaggagtgggcgctgcacaccttcccc
aatgccacggactactggacgttccggaagatgttcaccatccagctggctctgataggc
ttcgcggaattcgtcctgcatttaaatagactcaaccccgagatgttacagatcgctcag
gacactggcaaactgaatgttgcctactttcgatttgacataaacgacgcgactggagac
ctggatgccaaccgtcctgtcccatttcgactcacgcccaacatttctgagtttctgacc
accatcggggtctccggcccgttgacagcgtccatgattgcggtcgcccggtgcttcgcc
cagccaaactttaaggtggatggcattctgaaaacggttctccgggacgagatcattgct
tggcacaaaaaaacacaagaggacacgtcctctcctctctcggccgccgggcagccagag
aacatggacagccagcaactggtgtccctggttcagaaagccgtcaccgccatcatgacc
cgcctgcacaacctcgcccagttcgaaggcggggaaagcaaggtgaacaccctggtggcc
gcggcaaacagcctggacaatctgtgccgcatggaccccgcctggcacccctggctgtga

DBGET integrated database retrieval system