KEGG   Homo sapiens (human): 8313Help
Entry
8313              CDS       T01001                                 

Gene name
AXIN2, AXIL, ODCRCS
Definition
axin 2
Orthology
K04385  
axin 2
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Pathways in cancer
Colorectal cancer
Endometrial cancer
Basal cell carcinoma
Disease
H00625  
Tooth agenesis
H00857  
Oligodontia-colorectal cancer syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8313 (AXIN2)
   04390 Hippo signaling pathway
    8313 (AXIN2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    8313 (AXIN2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8313 (AXIN2)
   05210 Colorectal cancer
    8313 (AXIN2)
   05217 Basal cell carcinoma
    8313 (AXIN2)
   05213 Endometrial cancer
    8313 (AXIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24.1
AA seq 843 aa AA seqDB search
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgctatgttggtgacttgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgacccggtggaccaag
tccttacactccttattgggcgatcaagacggtgcttacctgttccgaactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactcgggagcctaaaggtc
gtgtgtggctatctccccaccttgaatgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaaccgtggttggcttgtccagcaaaactctgagggccacggcgagt
gtgaggtccacggaaactgttgacagtggatacaggtccttcaagaggagcgatcctgtt
aatccttatcacataggttctggctatgtctttgcaccagccaccagcgccaacgacagt
gagatatccagtgatgcgctgacggatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcagctgagctgatctcgaggctggaaaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagagagagggctccgagctcacactcaattcgcgggagggggcgcccacgcag
caccccctctccctactgccctccggcagctacgaggaagacccgcagacgatactggac
gatcacctgtccagggtcctcaagacccctggctgccagtctccaggcgtaggccgctat
agcccccgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcccgcccggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaaaggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccac
caccatgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcagcgagtattactgctactcgaaatgcaaaagccactccaag
gctccggaaaccatgcccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacagcgggcacccccgcaccaccccccgtgcccacctgttcacc
caggaccctgcgatgcctcccctgaccccacccaacacgctggctcagctggaggaggcc
tgtcgcaggctagctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaatcattcggccactgttcagacgggagccacacccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccacgcgctccag
gccagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtgtttgaggag
atctgggaggatgagacggtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

DBGET integrated database retrieval system