KEGG   Homo sapiens (human): 83605Help
Entry
83605             CDS       T01001                                 

Gene name
CCM2, C7orf22, OSM, PP10187
Definition
(RefSeq) CCM2 scaffolding protein
Organism
hsa  Homo sapiens (human)
Disease
H00534  
Cerebral cavernous malformation
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p13
AA seq 444 aa AA seqDB search
MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLS
DYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNV
KLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAG
SLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTP
THHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ
DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEK
DSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE
WDRMISDISSDIEALGCSMDQDSA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggagggcaagaagggcaagaagcctggaattgtctcgccatttaaacgagta
ttcctaaaaggtgaaaagagtagagataagaaagcccatgagaaggtgacagagaggcgc
cctctgcacactgtggtgttgtcattgcctgagcgcgtcgagccagacagactgctgagc
gactatattgagaaggaggtaaagtatttaggtcagttaacgtccataccaggatacctg
aatccctccagtaggactgaaatcctgcatttcatagacaatgcaaagagagcccaccag
cttccgggacacttgactcaggagcacgatgctgtgctcagcctgtctgcgtacaacgtc
aagctggcctggagggacggggaggatatcatcctcagggtgcccatccatgacatcgcc
gccgtctcctatgttcgggatgacgctgcacacctggtggtcctgaagacagcccaggac
ccagggatctcccccagccagagtctgtgtgcggaaagttccagaggcctcagtgcaggc
tccctgtcggagagtgcagttgggcccgtggaggcatgctgcctggtcatcctggctgca
gagagcaaggtcgctgcggaggagctttgctgtctgctaggccaggtcttccaggttgtt
tacacggagtccaccatcgactttctggacagagcgatatttgatggggcctctaccccg
acccaccacctgtccctgcacagcgatgactcttctacaaaagtggacattaaggagacc
tacgaggtggaagccagcactttctgcttccctgaatctgtggatgtgggtggtgcatca
ccccacagcaagaccatcagtgagagcgagctgagcgccagcgccactgagctgctgcag
gactacatgctgacgctgcgcaccaagctgtcatcacaggagatccagcagtttgcagca
ctgctgcacgagtaccgcaatggggcctctatccacgagttctgcatcaacctgcggcag
ctctacggggacagccgcaagttcctgctgcttggtctgaggcccttcatccctgagaag
gacagccagcacttcgagaacttcctggagaccattggcgtgaaggatggccgcggcatc
atcactgacagctttggcaggcaccggcgggccctgagcaccacatccagttccaccacc
aatgggaacagggccacgggcagctctgatgaccggtcggcaccctcagagggggatgag
tgggaccgcatgatctcggacatcagcagcgacattgaggcgctgggctgcagcatggac
caggactcagcatga

DBGET integrated database retrieval system