KEGG   Homo sapiens (human): 83605Help
Entry
83605             CDS       T01001                                 

Gene name
CCM2, C7orf22, OSM
Definition
cerebral cavernous malformation 2
Organism
hsa  Homo sapiens (human)
Disease
H00534  
Cerebral cavernous malformation
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p13
AA seq 465 aa AA seqDB search
MHSSCRQRRNQNLSKEIPQTEFHTGYSMENEPGIVSPFKRVFLKGEKSRDKKAHEKVTER
RPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAH
QLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQ
DPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQV
VYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGA
SPHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLR
QLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSST
TNGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtagctgtcggcagaggaggaaccagaatctctccaaagaaattcctcaaaca
gaatttcacacagggtattccatggagaatgagcctggaattgtctcgccatttaaacga
gtattcctaaaaggtgaaaagagtagagataagaaagcccatgagaaggtgacagagagg
cgccctctgcacactgtggtgttgtcattgcctgagcgcgtcgagccagacagactgctg
agcgactatattgagaaggaggtaaagtatttaggtcagttaacgtccataccaggatac
ctgaatccctccagtaggactgaaatcctgcatttcatagacaatgcaaagagagcccac
cagcttccgggacacttgactcaggagcacgatgctgtgctcagcctgtctgcgtacaac
gtcaagctggcctggagggacggggaggatatcatcctcagggtgcccatccatgacatc
gccgccgtctcctatgttcgggatgacgctgcacacctggtggtcctgaagacagcccag
gacccagggatctcccccagccagagtctgtgtgcggaaagttccagaggcctcagtgca
ggctccctgtcggagagtgcagttgggcccgtggaggcatgctgcctggtcatcctggct
gcagagagcaaggtcgctgcggaggagctttgctgtctgctaggccaggtcttccaggtt
gtttacacggagtccaccatcgactttctggacagagcgatatttgatggggcctctacc
ccgacccaccacctgtccctgcacagcgatgactcttctacaaaagtggacattaaggag
acctacgaggtggaagccagcactttctgcttccctgaatctgtggatgtgggtggtgca
tcaccccacagcaagaccatcagtgagagcgagctgagcgccagcgccactgagctgctg
caggactacatgctgacgctgcgcaccaagctgtcatcacaggagatccagcagtttgca
gcactgctgcacgagtaccgcaatggggcctctatccacgagttctgcatcaacctgcgg
cagctctacggggacagccgcaagttcctgctgcttggtctgaggcccttcatccctgag
aaggacagccagcacttcgagaacttcctggagaccattggcgtgaaggatggccgcggc
atcatcactgacagctttggcaggcaccggcgggccctgagcaccacatccagttccacc
accaatgggaacagggccacgggcagctctgatgaccggtcggcaccctcagagggggat
gagtgggaccgcatgatctcggacatcagcagcgacattgaggcgctgggctgcagcatg
gaccaggactcagcatga

DBGET integrated database retrieval system