KEGG   Homo sapiens (human): 84668Help
Entry
84668             CDS       T01001                                 

Gene name
FAM126A, DRCTNNB1A, HCC, HLD5, HYCC1
Definition
family with sequence similarity 126, member A
Organism
hsa  Homo sapiens (human)
Disease
H00679  
Hypomyelinating leukodystrophy (HLD)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15.3
AA seq 521 aa AA seqDB search
MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQL
FEFYRSGEEQLLQFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKQGHT
KVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEV
LTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQM
LTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPHGPMKSNKEGTRC
IQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEGFYSRAASSTS
QSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLEL
LSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANR
FSACSLQEEKLIYVSERTELPMKHQSGQQRPPSISITLSTD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttcagagaaaggggttgtggaggaatggttgtcagagtttaagacattacca
gaaacatctttaccaaattatgccacaaatttgaaagacaagagttctttagtttcatct
ctctataaagttatccaggagccacaaagtgagttgctagaacctgtctgtcaccagctc
tttgaattctatcgcagtggagaggagcagttgcttcaatttacgctgcaatttctccca
gaactaatttggtgctaccttgcagtctcagccagcagaaatgtgcatagcagtggatgc
attgaagctcttcttctaggggtttacaatttggaaatagttgacaaacagggacatacc
aaagtattgagttttacgattccatctttatccaaaccatctgtataccatgaaccttcc
agcattgggtccatggctctgactgagagtgcactatcccagcatggtttgtcaaaagtg
gtatacagtggacctcatcctcaaagggagatgctgacagcacagaatcggtttgaagtg
ttgacattccttttgttgtgttacaatgctgccttaacttacatgcccagtgtttctctt
cagtcactgtgtcaaatttgttcaagaatctgtgtttgtggatatcctcgacaacatgta
agaaaatataaaggtataagtagcaggataccagtttcttcaggattcatggtgcaaatg
ttaacagggatttattttgccttttataatggagaatgggatctagctcaaaaagcactg
gatgatattatatacagagcccagctagaattatatccagagccattgctggttgctaat
gcaataaaggcttcattgcctcatggtcccatgaaatctaataaggaaggtacaaggtgt
attcaagttgaaatcacaccaacttcctctcgaatatcaagaaatgcagtaaccagcatg
tcaataaggggtcataggtggaaaagacatggaaatacagaattaacaggtcaagaagaa
ctgatggagatatctgaagttgacgagggattttattccagggctgcgtctagtaccagc
cagtcgggtttatcaaacagtagtcacaattgtagtaacaagccaagtataggaaagaac
cacagacggtcaggaggaagcaaaactggaggaaaagaaaaagaaactacaggggaatct
tgcaaagatcactttgctcgaaaacaaactcagagagcccaaagtgagaatcttgagctt
ctctctttgaagagacttactttaacaaccagccaatccctacctaagcctagtagccat
ggtttggctaagaccgcagcgactgtatttagtaaatcctttgaacaagtcagtggtgtc
acagtcccacataacccgtcatctgctgttggttgtggggctgggacagatgccaatagg
ttttccgcttgtagtctccaagaagaaaagcttatttacgtttcagaaagaactgaactt
ccaatgaagcatcaatcaggtcagcagagacctcctagtattagcattactctgtccaca
gattaa

DBGET integrated database retrieval system