KEGG   Homo sapiens (human): 84676Help
Entry
84676             CDS       T01001                                 

Gene name
TRIM63, IRF, MURF1, MURF2, RNF28, SMRZ
Definition
(RefSeq) tripartite motif containing 63
  KO
K10655  
tripartite motif-containing protein 63 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84676 (TRIM63)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    84676 (TRIM63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q969Q1(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.11
AA seq 353 aa AA seqDB search
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWT
SRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHP
MCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTELNNCISMLVAG
NDRVQTIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLS
FIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggattataagtcgagcctgatccaggatgggaatcccatggagaacttggagaagcag
ctgatctgccctatctgcctggagatgtttaccaagccagtggtcatcttgccgtgccag
cacaacctgtgccggaagtgtgccaatgacatcttccaggctgcaaatccctactggacc
agccggggcagctcagtgtccatgtctggaggccgtttccgctgccccacctgccgccac
gaggtgatcatggatcgtcacggagtgtacggcctgcagaggaacctgctggtggagaac
atcatcgacatctacaaacaggagtgctccagtcggccgctgcagaagggcagtcacccc
atgtgcaaggagcacgaagatgagaaaatcaacatctactgtctcacgtgtgaggtgccc
acctgctccatgtgcaaggtgtttgggatccacaaggcctgcgaggtggccccattgcag
agtgtcttccagggacaaaagactgaactgaataactgtatctccatgctggtggcgggg
aatgaccgtgtgcagaccatcatcactcagctggaggattcccgtcgagtgaccaaggag
aacagtcaccaggtaaaggaagagctgagccagaagtttgacacgttgtatgccatcctg
gatgagaagaaaagtgagttgctgcagcggatcacgcaggagcaggagaaaaagcttagc
ttcatcgaggccctcatccagcagtaccaggagcagctggacaagtccacaaagctggtg
gaaactgccatccagtccctggacgagcctgggggagccaccttcctcttgactgccaag
caactcatcaaaagcattgtggaagcttccaagggctgccagctggggaagacagagcag
ggctttgagaacatggacttctttactttggatttagagcacatagcagacgccctgaga
gccattgactttgggacagatgaggaagaggaagaattcattgaagaagaagatcaggaa
gaggaagagtccacagaagggaaggaagaaggacaccagtaa

DBGET integrated database retrieval system