KEGG   Homo sapiens (human): 8518Help
Entry
8518              CDS       T01001                                 

Gene name
IKBKAP, DYS, ELP1, FD, IKAP, IKI3, TOT1
Definition
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Orthology
K11373  
elongator complex protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31
AA seq 1332 aa AA seqDB search
MRNLKLFRTLEFRDIQGPGNPQCFSLRTEQGTVLIGSEHGLIEVDPVSREVKNEVSLVAE
GFLPEDGSGRIVGVQDLLDQESVCVATASGDVILCSLSTQQLECVGSVASGISVMSWSPD
QELVLLATGQQTLIMMTKDFEPILEQQIHQDDFGESKFITVGWGRKETQFHGSEGRQAAF
QMQMHESALPWDDHRPQVTWRGDGQFFAVSVVCPETGARKVRVWNREFALQSTSEPVAGL
GPALAWKPSGSLIASTQDKPNQQDIVFFEKNGLLHGHFTLPFLKDEVKVNDLLWNADSSV
LAVWLEDLQREESSIPKTCVQLWTVGNYHWYLKQSLSFSTCGKSKIVSLMWDPVTPYRLH
VLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLF
PHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVGGSGFKVCLRTP
HLEKRYKIQFENNEDQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHHLTAASSEMDE
EHGQLNVSSSAAVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAIKPWKNSGGFP
VRFPYPCTQTELAMIGEEECVLGLTDRCRFFINDIEVASNITSFAVYDEFLLLTTHSHTC
QCFCLRDASFKTLQAGLSSNHVSHGEVLRKVERGSRIVTVVPQDTKLVLQMPRGNLEVVH
HRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLGNVETFIKQIDSVNHI
NLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKIDLVCDAMRAVMESINPHKYCLSIL
TSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLHLVDVNELYDHSLGTYDF
DLVLMVAEKSQKDPKEYLPFLNTLKKMETNYQRFTIDKYLKRYEKAIGHLSKCGPEYFPE
CLNLIKDKNLYNEALKLYSPSSQQYQDISIAYGEHLMQEHMYEPAGLMFARCGAHEKALS
AFLTCGNWKQALCVAAQLNFTKDQLVGLGRTLAGKLVEQRKHIDAAMVLEECAQDYEEAV
LLLLEGAAWEEALRLVYKYNRLDIIETNVKPSILEAQKNYMAFLDSQTATFSRHKKRLLV
VRELKEQAQQAGLDDEVPHGQESDLFSETSSVVSGSEMSGKYSHSNSRISARSSKNRRKA
ERKKHSLKEGSPLEDLALLEALSEVVQNTENLKDEVYHILKVLFLFEFDEQGRELQKAFE
DTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKI
NRRTQWKLSLLD
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaatctgaaattatttcggaccctggagttcagggatattcaaggtccagggaat
cctcagtgcttctctctccgaactgaacaggggacggtgctcattggttcagaacatggc
ctgatagaagtagaccctgtctcaagagaagtgaaaaatgaagtttctttggtggcagaa
ggctttctcccagaggatggaagtggccgcattgttggtgttcaggacttgctggatcag
gagtctgtgtgtgtggccacagcctctggagacgtcatactctgcagtctcagcacacaa
cagctggagtgtgttgggagtgtagccagtggtatctctgttatgagttggagtcctgac
caagagctggtgcttcttgccacaggtcaacagaccctgattatgatgacaaaagatttt
gagccaatcctggagcagcagatccatcaggatgattttggtgaaagcaagtttatcact
gttggatggggtaggaaggagacacagttccatggatcagaaggcagacaagcagctttt
cagatgcaaatgcatgagtctgctttgccctgggatgaccatagaccacaagttacctgg
cggggggatggacagttttttgctgtgagtgttgtttgcccagaaacaggggctcggaag
gtcagagtgtggaaccgagagtttgctttgcagtcaaccagtgagcctgtggcaggactg
ggaccagccctggcttggaaaccctcaggcagtttgattgcatctacacaagataaaccc
aaccagcaggatattgtgttttttgagaaaaatggactccttcatggacactttacactt
cccttccttaaagatgaggttaaggtaaatgacttgctctggaatgcagattcctctgtg
cttgcagtctggctggaagaccttcagagagaagaaagctccattccgaaaacctgtgtt
cagctctggactgttggaaactatcactggtatctcaagcaaagtttatccttcagcacc
tgtgggaagagcaagattgtgtctctgatgtgggaccctgtgaccccataccggctgcat
gttctctgtcagggctggcattacctcgcctatgattggcactggacgactgaccggagc
gtgggagataattcaagtgacttgtccaatgtggctgtcattgatggaaacagggtgttg
gtgacagtcttccggcagactgtggttccgcctcccatgtgcacctaccaactgctgttc
ccacaccctgtgaatcaagtcacattcttagcacaccctcaaaagagtaatgaccttgct
gttctagatgccagtaaccagatttctgtttataaatgtggtgattgtccaagtgctgac
cctacagtgaaactgggagctgtgggtggaagtggatttaaagtttgccttagaactcct
catttggaaaagagatacaaaatccagtttgagaataatgaagatcaagatgtaaacccg
ctgaaactaggccttctcacttggattgaagaagacgtcttcctggctgtaagccacagt
gagttcagcccccggtctgtcattcaccatttgactgcagcttcttctgagatggatgaa
gagcatggacagctcaatgtcagttcatctgcagcggtggatggggtcataatcagtcta
tgttgcaattccaagaccaagtcagtagtattacagctggctgatggccagatatttaag
tacctttgggagtcaccttctctggctattaaaccatggaagaactctggtggatttcct
gttcggtttccttatccatgcacccagaccgaattggccatgattggagaagaggaatgt
gtccttggtctgactgacaggtgtcgctttttcatcaatgacattgaggttgcgtcaaat
atcacgtcatttgcagtatatgatgagtttttattgttgacaacccattcccatacctgc
cagtgtttttgcctgagggatgcttcatttaaaacattacaggccggcctgagcagcaat
catgtgtcccatggggaagttctgcggaaagtggagaggggttcacggattgtcactgtt
gtgccccaggacacaaagcttgtattacagatgccaaggggaaacttagaagttgttcat
catcgagccctggttttagctcagattcggaagtggttggacaaacttatgtttaaagag
gcatttgaatgcatgagaaagctgagaatcaatctcaatctgatttatgatcataaccct
aaggtgtttcttggaaatgtggaaaccttcattaaacagatagattctgtgaatcatatt
aacttgttttttacagaattgaaagaagaagatgtcacgaagaccatgtaccctgcacca
gttaccagcagtgtctacctgtccagggatcctgacgggaataaaatagaccttgtctgc
gatgctatgagagcagtcatggagagcataaatcctcataaatactgcctatccatactt
acatctcatgtaaagaagacaaccccagaactggaaattgtactgcaaaaagtacacgag
cttcaaggaaatgctccctctgatcctgatgctgtgagtgctgaagaggccttgaaatat
ttgctgcatctggtagatgttaatgaattatatgatcattctcttggcacctatgacttt
gatttggtcctcatggtagctgagaagtcacagaaggatcccaaagaatatcttccattt
cttaatacacttaagaaaatggaaactaattatcagcggtttactatagacaaatacttg
aaacgatatgaaaaagccattggccacctcagcaaatgtggacctgagtacttcccagaa
tgcttaaacttgataaaagataaaaacttgtataacgaagctctgaagttatattcacca
agctcacaacagtaccaggatatcagcattgcttatggggagcacctgatgcaggagcac
atgtatgagccagcggggctcatgtttgcccgttgcggtgcccacgagaaagctctctca
gcctttctgacatgtggcaactggaagcaagccctctgtgtggcagcccagcttaacttt
accaaagaccagctggtgggcctcggcagaactctggcaggaaagctggttgagcagagg
aagcacattgatgcggccatggttttggaagagtgtgcccaggattatgaagaagctgtg
ctcttgctgttagaaggagctgcctgggaagaagctttgaggctggtatacaaatataac
agactggatattatagaaaccaacgtaaagccttccattttagaagcccagaaaaattat
atggcatttctggactctcagacagccacattcagtcgccacaagaaacgtttattggta
gttcgagagctcaaggagcaagcccagcaggcaggtctggatgatgaggtaccccacggg
caagagtcagacctcttctctgaaactagcagtgtcgtgagtggcagtgagatgagtggc
aaatactcccatagtaactccaggatatcagcgagatcatccaagaatcgccgaaaagcg
gagcggaagaagcacagcctcaaagaaggcagtccgctggaggacctggccctcctggag
gcactgagtgaagtggtgcagaacactgaaaacctgaaagatgaagtataccatatttta
aaggtactctttctctttgagtttgatgaacaaggaagggaattacagaaggcctttgaa
gatacgctgcagttgatggaaaggtcacttccagaaatttggactcttacttaccagcag
aattcagctaccccggttctaggtcccaattctactgcaaatagtatcatggcatcttat
cagcaacagaagacttcggttcctgttcttgatgctgagctttttataccaccaaagatc
aacagaagaacccagtggaagctgagcctgctagactga

DBGET integrated database retrieval system